Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5718
Gene name Gene Name - the full gene name approved by the HGNC.
Proteasome 26S subunit, non-ATPase 12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PSMD12
Synonyms (NCBI Gene) Gene synonyms aliases
Rpn5, STISS, p55
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs895130488 G>A,T Pathogenic Synonymous variant, coding sequence variant, non coding transcript variant, stop gained
rs1114167442 G>A,C Pathogenic Coding sequence variant, non coding transcript variant, missense variant, stop gained
rs1114167443 A>C Pathogenic Coding sequence variant, non coding transcript variant, stop gained
rs1114167444 T>C Pathogenic Splice acceptor variant, non coding transcript variant
rs1403781576 C>A,G Pathogenic Stop gained, missense variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021584 hsa-miR-142-3p Microarray 17612493
MIRT021773 hsa-miR-132-3p Microarray 17612493
MIRT031616 hsa-miR-16-5p Proteomics 18668040
MIRT1270439 hsa-miR-2113 CLIP-seq
MIRT1270440 hsa-miR-4742-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000502 Component Proteasome complex IDA 17323924
GO:0000502 Component Proteasome complex IEA
GO:0000502 Component Proteasome complex NAS 29636472
GO:0005515 Function Protein binding IPI 16990800, 26030138, 28514442, 33961781, 35271311
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604450 9557 ENSG00000197170
Protein
UniProt ID O00232
Protein name 26S proteasome non-ATPase regulatory subunit 12 (26S proteasome regulatory subunit RPN5) (26S proteasome regulatory subunit p55)
Protein function Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
PDB 5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F , 7W3G , 7W3H , 7W3I , 7W3J , 7W3K , 7W3M
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01399 PCI 300 417 PCI domain Domain
PF18098 RPN5_C 422 454 26S proteasome regulatory subunit RPN5 C-terminal domain Domain
Sequence
MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLEKQTRTASDM
VSTSRILVAVVKMCYEAKEWDLLNENIMLLSKRRSQLKQAVAKMVQQCCTYVEEITDLPI
KLRLIDTLRMVTEGKIYVEIERARLTKTLATIKEQNGDVKEAASILQELQVETYGSMEKK
ERVEFILEQMRLCLAVKDYIRTQIISKKINTKFFQEENTEKLKLKYYNLMIQLDQHEGSY
LSICKHYRAIYDTPCIQAESEKWQQALKSVVLYVILAPFDNEQSDLVHRISGDKKLEEIP
KYKDLLKLFTTMELMRWSTLVEDYGMELRKGSLESPATDVFGSTEEGEKRWKDLKNRVVE
HNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQR
PKD
PNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ
Sequence length 456
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
STANKIEWICZ-ISIDOR SYNDROME stankiewicz-isidor syndrome rs1114167442, rs1114167443, rs895130488, rs1114167444, rs1403781576, rs1598574154 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Mental retardation syndromic intellectual disability N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 34818353
Adenocarcinoma of Lung Associate 40528170
Autism Spectrum Disorder Associate 30421579
Autistic Disorder Associate 30421579
Brain Neoplasms Stimulate 40528170
Breast Neoplasms Stimulate 34839279
Carcinoma Hepatocellular Associate 36137220
Colonic Neoplasms Associate 35712285
Developmental Disabilities Associate 30421579, 34906456, 35080150
Diastrophic dysplasia Associate 34906456