Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5716
Gene name Gene Name - the full gene name approved by the HGNC.
Proteasome 26S subunit, non-ATPase 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PSMD10
Synonyms (NCBI Gene) Gene synonyms aliases
dJ889N15.2, p28, p28(GANK)
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq22.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT023306 hsa-miR-122-5p Proteomics 21750653
MIRT035545 hsa-miR-214-3p Luciferase reporter assay 23100276
MIRT044545 hsa-miR-320a CLASH 23622248
MIRT036871 hsa-miR-877-3p CLASH 23622248
MIRT438269 hsa-miR-605-5p Luciferase reporter assay, Western blot 25131931
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 16023600
GO:0000502 Component Proteasome complex IDA 17323924
GO:0000502 Component Proteasome complex TAS 8811196
GO:0005515 Function Protein binding IPI 10613832, 11900540, 12525503, 16023600, 16189514, 17003112, 18040287, 19490896, 21988832, 24338975, 25416956, 26972000, 32296183, 33961781, 35271311
GO:0005634 Component Nucleus IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300880 9555 ENSG00000101843
Protein
UniProt ID O75832
Protein name 26S proteasome non-ATPase regulatory subunit 10 (26S proteasome regulatory subunit p28) (Gankyrin) (p28(GANK))
Protein function Acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably a
PDB 1QYM , 1TR4 , 1UOH , 4NIK , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 7VO6 , 7VXV , 7VXW , 7VY4 , 7VY7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 8 103 Ankyrin repeats (3 copies) Repeat
PF13637 Ank_4 40 93 Repeat
PF13637 Ank_4 73 126 Repeat
PF13637 Ank_4 139 184 Repeat
Tissue specificity TISSUE SPECIFICITY: Tends to be up-regulated in cancer cells with RAS mutations, including lung cancers and adenocarconimas (at protein level). {ECO:0000269|PubMed:10613832, ECO:0000269|PubMed:20628200}.
Sequence
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
QLGVPVNDKDDA
GWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
IAVMLL
EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC
DEER
VEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
Sequence length 226
Interactions View interactions
<