Gene Gene information from NCBI Gene database.
Entrez ID 5716
Gene name Proteasome 26S subunit, non-ATPase 10
Gene symbol PSMD10
Synonyms (NCBI Gene)
dJ889N15.2p28p28(GANK)
Chromosome X
Chromosome location Xq22.3
Summary This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in
miRNA miRNA information provided by mirtarbase database.
201
miRTarBase ID miRNA Experiments Reference
MIRT023306 hsa-miR-122-5p Proteomics 21750653
MIRT035545 hsa-miR-214-3p Luciferase reporter assay 23100276
MIRT044545 hsa-miR-320a CLASH 23622248
MIRT036871 hsa-miR-877-3p CLASH 23622248
MIRT438269 hsa-miR-605-5p Luciferase reporter assayWestern blot 25131931
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 16023600
GO:0000502 Component Proteasome complex IDA 17323924
GO:0000502 Component Proteasome complex TAS 8811196
GO:0005515 Function Protein binding IPI 10613832, 11900540, 12525503, 16023600, 16189514, 17003112, 18040287, 19490896, 21988832, 24338975, 25416956, 26972000, 32296183, 33961781, 35271311
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300880 9555 ENSG00000101843
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75832
Protein name 26S proteasome non-ATPase regulatory subunit 10 (26S proteasome regulatory subunit p28) (Gankyrin) (p28(GANK))
Protein function Acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably a
PDB 1QYM , 1TR4 , 1UOH , 4NIK , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 7VO6 , 7VXV , 7VXW , 7VY4 , 7VY7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12796 Ank_2 8 103 Ankyrin repeats (3 copies) Repeat
PF13637 Ank_4 40 93 Repeat
PF13637 Ank_4 73 126 Repeat
PF13637 Ank_4 139 184 Repeat
Tissue specificity TISSUE SPECIFICITY: Tends to be up-regulated in cancer cells with RAS mutations, including lung cancers and adenocarconimas (at protein level). {ECO:0000269|PubMed:10613832, ECO:0000269|PubMed:20628200}.
Sequence
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
QLGVPVNDKDDA
GWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
IAVMLL
EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC
DEER
VEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
Sequence length 226
Interactions View interactions