Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5716
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, non-ATPase 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMD10
Synonyms (NCBI Gene) Gene synonyms aliases	dJ889N15.2, p28, p28(GANK)
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq22.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in

Show/Hide all(201)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023306	hsa-miR-122-5p	Proteomics	21750653
MIRT035545	hsa-miR-214-3p	Luciferase reporter assay	23100276
MIRT044545	hsa-miR-320a	CLASH	23622248
MIRT036871	hsa-miR-877-3p	CLASH	23622248
MIRT438269	hsa-miR-605-5p	Luciferase reporter assay, Western blot	25131931
MIRT438269	hsa-miR-605-5p	Luciferase reporter assay, Western blot	25131931
MIRT1270395	hsa-miR-1254	CLIP-seq
MIRT1270396	hsa-miR-1303	CLIP-seq
MIRT1270397	hsa-miR-1470	CLIP-seq
MIRT1270398	hsa-miR-188-5p	CLIP-seq
MIRT1270399	hsa-miR-214	CLIP-seq
MIRT1270400	hsa-miR-216a	CLIP-seq
MIRT1270401	hsa-miR-2964a-5p	CLIP-seq
MIRT1270402	hsa-miR-3116	CLIP-seq
MIRT1270403	hsa-miR-3145-5p	CLIP-seq
MIRT1270404	hsa-miR-3148	CLIP-seq
MIRT1270405	hsa-miR-323-3p	CLIP-seq
MIRT1270406	hsa-miR-3619-5p	CLIP-seq
MIRT1270407	hsa-miR-3662	CLIP-seq
MIRT1270408	hsa-miR-376a	CLIP-seq
MIRT1270409	hsa-miR-376b	CLIP-seq
MIRT1270410	hsa-miR-380	CLIP-seq
MIRT1270411	hsa-miR-421	CLIP-seq
MIRT1270412	hsa-miR-425	CLIP-seq
MIRT1270413	hsa-miR-4291	CLIP-seq
MIRT1270414	hsa-miR-431	CLIP-seq
MIRT1270415	hsa-miR-4432	CLIP-seq
MIRT1270416	hsa-miR-4495	CLIP-seq
MIRT1270417	hsa-miR-4667-3p	CLIP-seq
MIRT1270418	hsa-miR-4691-3p	CLIP-seq
MIRT1270419	hsa-miR-4709-5p	CLIP-seq
MIRT1270420	hsa-miR-4719	CLIP-seq
MIRT1270421	hsa-miR-493	CLIP-seq
MIRT1270422	hsa-miR-499-5p	CLIP-seq
MIRT1270423	hsa-miR-505	CLIP-seq
MIRT1270424	hsa-miR-508-5p	CLIP-seq
MIRT1270425	hsa-miR-512-5p	CLIP-seq
MIRT1270426	hsa-miR-539	CLIP-seq
MIRT1270427	hsa-miR-570	CLIP-seq
MIRT1270428	hsa-miR-581	CLIP-seq
MIRT1270429	hsa-miR-642b	CLIP-seq
MIRT1270430	hsa-miR-661	CLIP-seq
MIRT1270431	hsa-miR-761	CLIP-seq
MIRT1270432	hsa-miR-873	CLIP-seq
MIRT1270433	hsa-miR-875-3p	CLIP-seq
MIRT1270434	hsa-miR-922	CLIP-seq
MIRT2079457	hsa-miR-4453	CLIP-seq
MIRT2079458	hsa-miR-4538	CLIP-seq
MIRT2079459	hsa-miR-4633-3p	CLIP-seq
MIRT2079460	hsa-miR-4661-5p	CLIP-seq
MIRT2305760	hsa-miR-1197	CLIP-seq
MIRT1270399	hsa-miR-214	CLIP-seq
MIRT2305761	hsa-miR-3144-5p	CLIP-seq
MIRT2305762	hsa-miR-3191	CLIP-seq
MIRT1270405	hsa-miR-323-3p	CLIP-seq
MIRT1270406	hsa-miR-3619-5p	CLIP-seq
MIRT2305763	hsa-miR-3674	CLIP-seq
MIRT2305764	hsa-miR-3942-3p	CLIP-seq
MIRT1270413	hsa-miR-4291	CLIP-seq
MIRT2305765	hsa-miR-4652-5p	CLIP-seq
MIRT2305766	hsa-miR-4667-5p	CLIP-seq
MIRT2305767	hsa-miR-4700-5p	CLIP-seq
MIRT1270420	hsa-miR-4719	CLIP-seq
MIRT1270423	hsa-miR-505	CLIP-seq
MIRT1270425	hsa-miR-512-5p	CLIP-seq
MIRT1270431	hsa-miR-761	CLIP-seq
MIRT1270432	hsa-miR-873	CLIP-seq
MIRT1270434	hsa-miR-922	CLIP-seq
MIRT2602996	hsa-miR-1245b-5p	CLIP-seq
MIRT1270395	hsa-miR-1254	CLIP-seq
MIRT2602997	hsa-miR-1258	CLIP-seq
MIRT2602998	hsa-miR-1265	CLIP-seq
MIRT2602999	hsa-miR-1273d	CLIP-seq
MIRT1270396	hsa-miR-1303	CLIP-seq
MIRT1270399	hsa-miR-214	CLIP-seq
MIRT1270400	hsa-miR-216a	CLIP-seq
MIRT2603000	hsa-miR-2278	CLIP-seq
MIRT2603001	hsa-miR-2392	CLIP-seq
MIRT2603002	hsa-miR-30a	CLIP-seq
MIRT2603003	hsa-miR-30b	CLIP-seq
MIRT2603004	hsa-miR-30c	CLIP-seq
MIRT2603005	hsa-miR-30d	CLIP-seq
MIRT2603006	hsa-miR-30e	CLIP-seq
MIRT1270402	hsa-miR-3116	CLIP-seq
MIRT2603007	hsa-miR-3126-3p	CLIP-seq
MIRT2603008	hsa-miR-3128	CLIP-seq
MIRT2603009	hsa-miR-3142	CLIP-seq
MIRT1270403	hsa-miR-3145-5p	CLIP-seq
MIRT1270404	hsa-miR-3148	CLIP-seq
MIRT1270405	hsa-miR-323-3p	CLIP-seq
MIRT2603010	hsa-miR-331-5p	CLIP-seq
MIRT2603011	hsa-miR-3613-3p	CLIP-seq
MIRT1270406	hsa-miR-3619-5p	CLIP-seq
MIRT2603012	hsa-miR-3653	CLIP-seq
MIRT2603013	hsa-miR-3658	CLIP-seq
MIRT2603014	hsa-miR-376c	CLIP-seq
MIRT2603015	hsa-miR-3919	CLIP-seq
MIRT2603016	hsa-miR-3928	CLIP-seq
MIRT2305764	hsa-miR-3942-3p	CLIP-seq
MIRT1270411	hsa-miR-421	CLIP-seq
MIRT1270413	hsa-miR-4291	CLIP-seq
MIRT2603017	hsa-miR-4307	CLIP-seq
MIRT2079457	hsa-miR-4453	CLIP-seq
MIRT2079458	hsa-miR-4538	CLIP-seq
MIRT2079459	hsa-miR-4633-3p	CLIP-seq
MIRT2603018	hsa-miR-4652-3p	CLIP-seq
MIRT2079460	hsa-miR-4661-5p	CLIP-seq
MIRT2603019	hsa-miR-4678	CLIP-seq
MIRT1270418	hsa-miR-4691-3p	CLIP-seq
MIRT1270419	hsa-miR-4709-5p	CLIP-seq
MIRT2603020	hsa-miR-4720-5p	CLIP-seq
MIRT2603021	hsa-miR-4756-3p	CLIP-seq
MIRT2603022	hsa-miR-4765	CLIP-seq
MIRT2603023	hsa-miR-4773	CLIP-seq
MIRT2603024	hsa-miR-4799-3p	CLIP-seq
MIRT2603025	hsa-miR-4802-5p	CLIP-seq
MIRT2603026	hsa-miR-494	CLIP-seq
MIRT1270423	hsa-miR-505	CLIP-seq
MIRT1270424	hsa-miR-508-5p	CLIP-seq
MIRT1270425	hsa-miR-512-5p	CLIP-seq
MIRT2603027	hsa-miR-548a-3p	CLIP-seq
MIRT2603028	hsa-miR-548aa	CLIP-seq
MIRT2603029	hsa-miR-548e	CLIP-seq
MIRT2603030	hsa-miR-548f	CLIP-seq
MIRT1270427	hsa-miR-570	CLIP-seq
MIRT1270429	hsa-miR-642b	CLIP-seq
MIRT2603031	hsa-miR-651	CLIP-seq
MIRT1270430	hsa-miR-661	CLIP-seq
MIRT2603032	hsa-miR-759	CLIP-seq
MIRT1270431	hsa-miR-761	CLIP-seq
MIRT2603033	hsa-miR-765	CLIP-seq
MIRT1270432	hsa-miR-873	CLIP-seq
MIRT1270433	hsa-miR-875-3p	CLIP-seq
MIRT1270434	hsa-miR-922	CLIP-seq
MIRT2603034	hsa-miR-936	CLIP-seq
MIRT2602996	hsa-miR-1245b-5p	CLIP-seq
MIRT1270395	hsa-miR-1254	CLIP-seq
MIRT2602997	hsa-miR-1258	CLIP-seq
MIRT2602998	hsa-miR-1265	CLIP-seq
MIRT2602999	hsa-miR-1273d	CLIP-seq
MIRT1270396	hsa-miR-1303	CLIP-seq
MIRT1270399	hsa-miR-214	CLIP-seq
MIRT1270400	hsa-miR-216a	CLIP-seq
MIRT2603000	hsa-miR-2278	CLIP-seq
MIRT2603001	hsa-miR-2392	CLIP-seq
MIRT2603002	hsa-miR-30a	CLIP-seq
MIRT2603003	hsa-miR-30b	CLIP-seq
MIRT2603004	hsa-miR-30c	CLIP-seq
MIRT2603005	hsa-miR-30d	CLIP-seq
MIRT2603006	hsa-miR-30e	CLIP-seq
MIRT1270402	hsa-miR-3116	CLIP-seq
MIRT2603007	hsa-miR-3126-3p	CLIP-seq
MIRT2603008	hsa-miR-3128	CLIP-seq
MIRT2603009	hsa-miR-3142	CLIP-seq
MIRT1270403	hsa-miR-3145-5p	CLIP-seq
MIRT1270404	hsa-miR-3148	CLIP-seq
MIRT1270405	hsa-miR-323-3p	CLIP-seq
MIRT2603010	hsa-miR-331-5p	CLIP-seq
MIRT2603011	hsa-miR-3613-3p	CLIP-seq
MIRT1270406	hsa-miR-3619-5p	CLIP-seq
MIRT2603012	hsa-miR-3653	CLIP-seq
MIRT2603013	hsa-miR-3658	CLIP-seq
MIRT1270407	hsa-miR-3662	CLIP-seq
MIRT2603014	hsa-miR-376c	CLIP-seq
MIRT2603016	hsa-miR-3928	CLIP-seq
MIRT2305764	hsa-miR-3942-3p	CLIP-seq
MIRT1270411	hsa-miR-421	CLIP-seq
MIRT1270413	hsa-miR-4291	CLIP-seq
MIRT2603017	hsa-miR-4307	CLIP-seq
MIRT2079457	hsa-miR-4453	CLIP-seq
MIRT2079458	hsa-miR-4538	CLIP-seq
MIRT2079459	hsa-miR-4633-3p	CLIP-seq
MIRT2603018	hsa-miR-4652-3p	CLIP-seq
MIRT2079460	hsa-miR-4661-5p	CLIP-seq
MIRT2603019	hsa-miR-4678	CLIP-seq
MIRT1270418	hsa-miR-4691-3p	CLIP-seq
MIRT1270419	hsa-miR-4709-5p	CLIP-seq
MIRT2603020	hsa-miR-4720-5p	CLIP-seq
MIRT2603022	hsa-miR-4765	CLIP-seq
MIRT2603023	hsa-miR-4773	CLIP-seq
MIRT2603024	hsa-miR-4799-3p	CLIP-seq
MIRT2603025	hsa-miR-4802-5p	CLIP-seq
MIRT2603026	hsa-miR-494	CLIP-seq
MIRT1270423	hsa-miR-505	CLIP-seq
MIRT1270424	hsa-miR-508-5p	CLIP-seq
MIRT1270425	hsa-miR-512-5p	CLIP-seq
MIRT2603027	hsa-miR-548a-3p	CLIP-seq
MIRT2603028	hsa-miR-548aa	CLIP-seq
MIRT2603029	hsa-miR-548e	CLIP-seq
MIRT2603030	hsa-miR-548f	CLIP-seq
MIRT1270427	hsa-miR-570	CLIP-seq
MIRT1270429	hsa-miR-642b	CLIP-seq
MIRT2603031	hsa-miR-651	CLIP-seq
MIRT1270430	hsa-miR-661	CLIP-seq
MIRT2603032	hsa-miR-759	CLIP-seq
MIRT1270431	hsa-miR-761	CLIP-seq
MIRT2603033	hsa-miR-765	CLIP-seq
MIRT1270432	hsa-miR-873	CLIP-seq
MIRT1270433	hsa-miR-875-3p	CLIP-seq
MIRT1270434	hsa-miR-922	CLIP-seq
MIRT2603034	hsa-miR-936	CLIP-seq

Show/Hide all(49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16023600
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	10613832, 11900540, 12525503, 16023600, 16189514, 17003112, 19490896, 21988832, 24338975, 25416956, 26972000, 32296183
GO:0005634	Component	Nucleus	IDA	18040287
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	18040287
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007253	Process	Cytoplasmic sequestering of NF-kappaB	IDA	18040287
GO:0008134	Function	Transcription factor binding	IPI	18040287
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IDA	19490896
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016579	Process	Protein deubiquitination	TAS
GO:0030307	Process	Positive regulation of cell growth	IDA	10613832
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	16023600
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	18040287
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	16023600
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	TAS	10613832
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	16023600
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19729910
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043409	Process	Negative regulation of MAPK cascade	IMP	19729910
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	16023600
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	11900540
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070682	Process	Proteasome regulatory particle assembly	IMP	19490896
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IMP	19729910
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

MIM	HGNC	e!Ensembl
300880	9555	ENSG00000101843

Protein

UniProt ID

O75832

Protein name

26S proteasome non-ATPase regulatory subunit 10 (26S proteasome regulatory subunit p28) (Gankyrin) (p28(GANK))

Protein function

Acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably a

PDB

1QYM , 1TR4 , 1UOH , 4NIK , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 7VO6 , 7VXV , 7VXW , 7VY4 , 7VY7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12796	Ank_2	8 → 103	Ankyrin repeats (3 copies)	Repeat
PF13637	Ank_4	40 → 93		Repeat
PF13637	Ank_4	73 → 126		Repeat
PF13637	Ank_4	139 → 184		Repeat

Tissue specificity

TISSUE SPECIFICITY: Tends to be up-regulated in cancer cells with RAS mutations, including lung cancers and adenocarconimas (at protein level). {ECO:0000269|PubMed:10613832, ECO:0000269|PubMed:20628200}.

Sequence

MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
QLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
IAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC
DEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG

Sequence length

226

Interactions

View interactions

PSMD10 (proteasome 26S subunit, non-ATPase 10)