Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5706
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, ATPase 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMC6
Synonyms (NCBI Gene) Gene synonyms aliases	RPT5, SUG2, p42
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028910	hsa-miR-26b-5p	Microarray	19088304
MIRT1270370	hsa-miR-101	CLIP-seq
MIRT1270371	hsa-miR-1178	CLIP-seq
MIRT1270372	hsa-miR-144	CLIP-seq
MIRT1270373	hsa-miR-3182	CLIP-seq
MIRT1270374	hsa-miR-3613-3p	CLIP-seq
MIRT1270375	hsa-miR-3686	CLIP-seq
MIRT1270376	hsa-miR-371-5p	CLIP-seq
MIRT1270377	hsa-miR-371b-5p	CLIP-seq
MIRT1270378	hsa-miR-3915	CLIP-seq
MIRT1270379	hsa-miR-3928	CLIP-seq
MIRT1270380	hsa-miR-4517	CLIP-seq
MIRT1270381	hsa-miR-4659a-3p	CLIP-seq
MIRT1270382	hsa-miR-4659b-3p	CLIP-seq
MIRT1270383	hsa-miR-4698	CLIP-seq
MIRT1270384	hsa-miR-4742-3p	CLIP-seq
MIRT1270385	hsa-miR-4760-5p	CLIP-seq
MIRT1270386	hsa-miR-495	CLIP-seq
MIRT1270387	hsa-miR-513a-3p	CLIP-seq
MIRT1270388	hsa-miR-520d-5p	CLIP-seq
MIRT1270389	hsa-miR-524-5p	CLIP-seq
MIRT1270390	hsa-miR-545	CLIP-seq
MIRT1270391	hsa-miR-548c-3p	CLIP-seq
MIRT1270392	hsa-miR-570	CLIP-seq
MIRT1270393	hsa-miR-582-5p	CLIP-seq
MIRT1270394	hsa-miR-600	CLIP-seq
MIRT2079456	hsa-miR-338-5p	CLIP-seq
MIRT1270388	hsa-miR-520d-5p	CLIP-seq
MIRT1270389	hsa-miR-524-5p	CLIP-seq
MIRT1270371	hsa-miR-1178	CLIP-seq
MIRT1270374	hsa-miR-3613-3p	CLIP-seq
MIRT1270376	hsa-miR-371-5p	CLIP-seq
MIRT1270377	hsa-miR-371b-5p	CLIP-seq
MIRT1270383	hsa-miR-4698	CLIP-seq
MIRT1270390	hsa-miR-545	CLIP-seq
MIRT1270391	hsa-miR-548c-3p	CLIP-seq
MIRT1270371	hsa-miR-1178	CLIP-seq
MIRT2602989	hsa-miR-224	CLIP-seq
MIRT2602990	hsa-miR-3144-3p	CLIP-seq
MIRT2602991	hsa-miR-3160-5p	CLIP-seq
MIRT2602992	hsa-miR-323-3p	CLIP-seq
MIRT2602993	hsa-miR-323b-3p	CLIP-seq
MIRT2079456	hsa-miR-338-5p	CLIP-seq
MIRT1270376	hsa-miR-371-5p	CLIP-seq
MIRT1270377	hsa-miR-371b-5p	CLIP-seq
MIRT2602994	hsa-miR-3913-3p	CLIP-seq
MIRT1270380	hsa-miR-4517	CLIP-seq
MIRT1270383	hsa-miR-4698	CLIP-seq
MIRT2602995	hsa-miR-489	CLIP-seq
MIRT1270388	hsa-miR-520d-5p	CLIP-seq
MIRT1270389	hsa-miR-524-5p	CLIP-seq
MIRT1270390	hsa-miR-545	CLIP-seq
MIRT1270371	hsa-miR-1178	CLIP-seq
MIRT2602989	hsa-miR-224	CLIP-seq
MIRT2602990	hsa-miR-3144-3p	CLIP-seq
MIRT2602991	hsa-miR-3160-5p	CLIP-seq
MIRT2602992	hsa-miR-323-3p	CLIP-seq
MIRT2602993	hsa-miR-323b-3p	CLIP-seq
MIRT1270376	hsa-miR-371-5p	CLIP-seq
MIRT1270377	hsa-miR-371b-5p	CLIP-seq
MIRT2602994	hsa-miR-3913-3p	CLIP-seq
MIRT1270380	hsa-miR-4517	CLIP-seq
MIRT1270383	hsa-miR-4698	CLIP-seq
MIRT2602995	hsa-miR-489	CLIP-seq
MIRT1270388	hsa-miR-520d-5p	CLIP-seq
MIRT1270389	hsa-miR-524-5p	CLIP-seq
MIRT1270390	hsa-miR-545	CLIP-seq

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	9464850, 17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 16763564, 19490896, 20478047, 21516116, 25416956, 26496610, 26871637, 28514442, 29636472, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	10419517
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IC	9464850
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016887	Function	ATPase activity	TAS	9464850
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0030433	Process	Ubiquitin-dependent ERAD pathway	IBA	21873635
GO:0030674	Function	Protein-macromolecule adaptor activity	NAS	11590019
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031597	Component	Cytosolic proteasome complex	IBA	21873635
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

MIM	HGNC	e!Ensembl
602708	9553	ENSG00000100519

Protein

UniProt ID

P62333

Protein name

26S proteasome regulatory subunit 10B (26S proteasome AAA-ATPase subunit RPT4) (Proteasome 26S subunit ATPase 6) (Proteasome subunit p42)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4G , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 8CVT , 8JRI , 8JRT , 8JTI , 8K0G , 8USB , 8USC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16450	Prot_ATP_ID_OB	57 → 112	Proteasomal ATPase OB C-terminal domain	Domain
PF00004	AAA	170 → 303	ATPase family associated with various cellular activities (AAA)	Domain
PF17862	AAA_lid_3	325 → 369	AAA+ lid domain	Domain

Sequence

MADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEV
LKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVY
NMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGK
TLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGG
RRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIH
IDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHD
FVVQEDFMKAVRKVADSKKLESKLDYKPV

Sequence length

389

Interactions

View interactions

PSMC6 (proteasome 26S subunit, ATPase 6)