Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5704
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, ATPase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMC4
Synonyms (NCBI Gene) Gene synonyms aliases	MIP224, RPT3, S6, TBP-7, TBP7
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029325	hsa-miR-26b-5p	Microarray	19088304
MIRT051335	hsa-miR-15a-5p	CLASH	23622248
MIRT046684	hsa-miR-222-3p	CLASH	23622248
MIRT046684	hsa-miR-222-3p	CLASH	23622248
MIRT043323	hsa-miR-331-3p	CLASH	23622248
MIRT036915	hsa-miR-877-3p	CLASH	23622248
MIRT697079	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT697078	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT697077	hsa-miR-940	HITS-CLIP	23313552
MIRT697076	hsa-miR-3929	HITS-CLIP	23313552
MIRT697075	hsa-miR-4419b	HITS-CLIP	23313552
MIRT697074	hsa-miR-4478	HITS-CLIP	23313552
MIRT697073	hsa-miR-5690	HITS-CLIP	23313552
MIRT697072	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT697071	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT697070	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT697069	hsa-miR-1827	HITS-CLIP	23313552
MIRT697068	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT697067	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT697066	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT697065	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT697064	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT697063	hsa-miR-4281	HITS-CLIP	23313552
MIRT697062	hsa-miR-7977	HITS-CLIP	23313552
MIRT697061	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT697060	hsa-miR-133a-3p	HITS-CLIP	23313552
MIRT697059	hsa-miR-665	HITS-CLIP	23313552
MIRT697079	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT697078	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT697077	hsa-miR-940	HITS-CLIP	23313552
MIRT697076	hsa-miR-3929	HITS-CLIP	23313552
MIRT697075	hsa-miR-4419b	HITS-CLIP	23313552
MIRT697074	hsa-miR-4478	HITS-CLIP	23313552
MIRT697073	hsa-miR-5690	HITS-CLIP	23313552
MIRT697072	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT697071	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT697070	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT697069	hsa-miR-1827	HITS-CLIP	23313552
MIRT697068	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT697067	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT697066	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT697065	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT697064	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT697063	hsa-miR-4281	HITS-CLIP	23313552
MIRT697062	hsa-miR-7977	HITS-CLIP	23313552
MIRT697061	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT697060	hsa-miR-133a-3p	HITS-CLIP	23313552
MIRT697059	hsa-miR-665	HITS-CLIP	23313552

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	12525503, 16189514, 17292836, 19490896, 21988832, 22078707, 24338975, 25416956, 26496610, 29128334, 29636472, 29804830, 29892012, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	TAS	8603043
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016234	Component	Inclusion body	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016887	Function	ATPase activity	TAS	9473509
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0031597	Component	Cytosolic proteasome complex	IBA	21873635
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0036402	Function	Proteasome-activating ATPase activity	IEA
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045202	Component	Synapse	IBA	21873635
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

MIM	HGNC	e!Ensembl
602707	9551	ENSG00000013275

Protein

UniProt ID

P43686

Protein name

26S proteasome regulatory subunit 6B (26S proteasome AAA-ATPase subunit RPT3) (MB67-interacting protein) (MIP224) (Proteasome 26S subunit ATPase 4) (Tat-binding protein 7) (TBP-7)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

2DVW , 5GJQ , 5GJR , 5L4G , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16450	Prot_ATP_ID_OB	89 → 144	Proteasomal ATPase OB C-terminal domain	Domain
PF00004	AAA	202 → 335	ATPase family associated with various cellular activities (AAA)	Domain
PF17862	AAA_lid_3	357 → 401	AAA+ lid domain	Domain

Sequence

MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEY
IKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTID
RELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREA
VELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYL
GEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFD
QNVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITSKMNLSEEVDL
EDYVARPDKISGADINSICQESGMLAVRENRYIVLAKDFEKAYKTVIKKDEQEHEFYK

Sequence length

418

Interactions

View interactions

PSMC4 (proteasome 26S subunit, ATPase 4)