Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5702
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, ATPase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMC3
Synonyms (NCBI Gene) Gene synonyms aliases	DCIDP, RPT5, TBP1
Disease Acronyms (UniProt) Disease acronyms from UniProt database	DCIDP
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1177898071	T>C,G	Pathogenic	Intron variant

Show/Hide all(4)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050417	hsa-miR-23a-3p	CLASH	23622248
MIRT049107	hsa-miR-92a-3p	CLASH	23622248
MIRT049107	hsa-miR-92a-3p	CLASH	23622248
MIRT048151	hsa-miR-196a-5p	CLASH	23622248

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000932	Component	P-body	ISS
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	16713569, 16763564, 19490896, 24255178, 25416956, 28514442, 29636472, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	2194290
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016887	Function	ATPase activity	ISS	1429620
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036402	Function	Proteasome-activating ATPase activity	IEA
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0043921	Process	Modulation by host of viral transcription	IDA	2194290, 8419915
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19853614
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
186852	9549	ENSG00000165916

Protein

UniProt ID

P17980

Protein name

26S proteasome regulatory subunit 6A (26S proteasome AAA-ATPase subunit RPT5) (Proteasome 26S subunit ATPase 3) (Proteasome subunit P50) (Tat-binding protein 1) (TBP-1)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4G , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16450	Prot_ATP_ID_OB	90 → 165	Proteasomal ATPase OB C-terminal domain	Domain
PF00004	AAA	223 → 356	ATPase family associated with various cellular activities (AAA)	Domain
PF17862	AAA_lid_3	378 → 422	AAA+ lid domain	Domain

Sequence

MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVL
RVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGK
CAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDER
PTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEK
AGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEE
ARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY
MEGILEVQAKKKANLQYYA

Sequence length

439

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Disease term	Disease name	Source
Unknown
Neurodevelopmental Disorders	complex neurodevelopmental disorder, neurodevelopmental disorder	GenCC
Insomnia	Insomnia	GWAS
Hypertension	Hypertension	GWAS
Alzheimer disease	Alzheimer disease	GWAS
Neuroticism	Neuroticism	GWAS
Glaucoma	Glaucoma	GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	34329194
Carcinoma Hepatocellular	Associate	12733146
Carcinoma Non Small Cell Lung	Inhibit	32386284
Hepatitis B	Associate	35695579
Lymphatic Metastasis	Inhibit	32386284
Neoplasms	Associate	12733146, 32386284

PSMC3 (proteasome 26S subunit, ATPase 3)