Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5701
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 26S subunit, ATPase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMC2
Synonyms (NCBI Gene) Gene synonyms aliases	MSS1, Nbla10058, RPT1, S7
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

Show/Hide all(107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031892	hsa-miR-16-5p	Proteomics	18668040
MIRT041958	hsa-miR-484	CLASH	23622248
MIRT721125	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT721124	hsa-miR-5693	HITS-CLIP	19536157
MIRT721123	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT721122	hsa-miR-3161	HITS-CLIP	19536157
MIRT721121	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT721120	hsa-miR-599	HITS-CLIP	19536157
MIRT721125	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT721124	hsa-miR-5693	HITS-CLIP	19536157
MIRT721123	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT721122	hsa-miR-3161	HITS-CLIP	19536157
MIRT721121	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT721120	hsa-miR-599	HITS-CLIP	19536157
MIRT1270315	hsa-miR-127-5p	CLIP-seq
MIRT1270316	hsa-miR-1321	CLIP-seq
MIRT1270317	hsa-miR-144	CLIP-seq
MIRT1270318	hsa-miR-3175	CLIP-seq
MIRT1270319	hsa-miR-3606	CLIP-seq
MIRT1270320	hsa-miR-362-5p	CLIP-seq
MIRT1270321	hsa-miR-4419a	CLIP-seq
MIRT1270322	hsa-miR-4510	CLIP-seq
MIRT1270323	hsa-miR-4645-3p	CLIP-seq
MIRT1270324	hsa-miR-4709-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT1270326	hsa-miR-4739	CLIP-seq
MIRT1270327	hsa-miR-4756-5p	CLIP-seq
MIRT1270328	hsa-miR-4786-3p	CLIP-seq
MIRT1270329	hsa-miR-500b	CLIP-seq
MIRT1270330	hsa-miR-501-5p	CLIP-seq
MIRT1270331	hsa-miR-548n	CLIP-seq
MIRT1270332	hsa-miR-921	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270334	hsa-miR-219-2-3p	CLIP-seq
MIRT1270335	hsa-miR-2964a-3p	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270337	hsa-miR-3614-5p	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT1270339	hsa-miR-4477a	CLIP-seq
MIRT1270340	hsa-miR-4704-3p	CLIP-seq
MIRT1270341	hsa-miR-4796-5p	CLIP-seq
MIRT1270342	hsa-miR-5096	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT1270340	hsa-miR-4704-3p	CLIP-seq
MIRT2079454	hsa-miR-4775	CLIP-seq
MIRT1270341	hsa-miR-4796-5p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2079455	hsa-miR-570	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT2305759	hsa-miR-610	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT2602966	hsa-miR-1185	CLIP-seq
MIRT2602967	hsa-miR-1255a	CLIP-seq
MIRT2602968	hsa-miR-1255b	CLIP-seq
MIRT2602969	hsa-miR-2278	CLIP-seq
MIRT2602970	hsa-miR-3138	CLIP-seq
MIRT2602971	hsa-miR-324-5p	CLIP-seq
MIRT2602972	hsa-miR-338-3p	CLIP-seq
MIRT2602973	hsa-miR-3663-3p	CLIP-seq
MIRT2602974	hsa-miR-3668	CLIP-seq
MIRT2602975	hsa-miR-3679-5p	CLIP-seq
MIRT2602976	hsa-miR-3689a-3p	CLIP-seq
MIRT2602977	hsa-miR-3689c	CLIP-seq
MIRT2602978	hsa-miR-4252	CLIP-seq
MIRT2602979	hsa-miR-4496	CLIP-seq
MIRT2602980	hsa-miR-4520a-3p	CLIP-seq
MIRT2602981	hsa-miR-4666-3p	CLIP-seq
MIRT2602982	hsa-miR-4699-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT2602983	hsa-miR-4732-5p	CLIP-seq
MIRT2602984	hsa-miR-491-3p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2602985	hsa-miR-562	CLIP-seq
MIRT2602986	hsa-miR-580	CLIP-seq
MIRT2602987	hsa-miR-586	CLIP-seq
MIRT2602988	hsa-miR-941	CLIP-seq
MIRT2602966	hsa-miR-1185	CLIP-seq
MIRT2602967	hsa-miR-1255a	CLIP-seq
MIRT2602968	hsa-miR-1255b	CLIP-seq
MIRT2602969	hsa-miR-2278	CLIP-seq
MIRT2602970	hsa-miR-3138	CLIP-seq
MIRT2602971	hsa-miR-324-5p	CLIP-seq
MIRT2602973	hsa-miR-3663-3p	CLIP-seq
MIRT2602974	hsa-miR-3668	CLIP-seq
MIRT2602975	hsa-miR-3679-5p	CLIP-seq
MIRT2602976	hsa-miR-3689a-3p	CLIP-seq
MIRT2602977	hsa-miR-3689c	CLIP-seq
MIRT2602978	hsa-miR-4252	CLIP-seq
MIRT2602979	hsa-miR-4496	CLIP-seq
MIRT2602980	hsa-miR-4520a-3p	CLIP-seq
MIRT2602981	hsa-miR-4666-3p	CLIP-seq
MIRT2602982	hsa-miR-4699-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT2602983	hsa-miR-4732-5p	CLIP-seq
MIRT2602984	hsa-miR-491-3p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2602985	hsa-miR-562	CLIP-seq
MIRT2602986	hsa-miR-580	CLIP-seq
MIRT2602987	hsa-miR-586	CLIP-seq
MIRT2602988	hsa-miR-941	CLIP-seq

Show/Hide all(49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	9295362, 17323924
GO:0000932	Component	P-body	ISS
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0005515	Function	Protein binding	IPI	16189514, 16763564, 19490896, 21516116, 22078707, 22901813, 25416956, 26496610, 27107012, 28514442, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	9295362
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016887	Function	ATPase activity	IDA	9295362
GO:0017025	Function	TBP-class protein binding	IBA	21873635
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036402	Function	Proteasome-activating ATPase activity	IEA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043197	Component	Dendritic spine	IBA	21873635
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045899	Process	Positive regulation of RNA polymerase II transcription preinitiation complex assembly	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
154365	9548	ENSG00000161057

Protein

UniProt ID

P35998

Protein name

26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4G , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00004	AAA	212 → 345	ATPase family associated with various cellular activities (AAA)	Domain
PF17862	AAA_lid_3	367 → 411	AAA+ lid domain	Domain

Sequence

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN

Sequence length

433

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Diabetes	Diabetes			GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	34329194
Glioma	Stimulate	35287689
Glioma	Associate	38569452
Kidney Neoplasms	Associate	32972417
Nasopharyngeal Carcinoma	Stimulate	38123344
Neoplasms	Associate	35287689, 38123344, 38569452

PSMC2 (proteasome 26S subunit, ATPase 2)