Gene Gene information from NCBI Gene database.
Entrez ID 5700
Gene name Proteasome 26S subunit, ATPase 1
Gene symbol PSMC1
Synonyms (NCBI Gene)
NEDGTHP26S4RPT2S4p56
Chromosome 14
Chromosome location 14q32.11
Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a
miRNA miRNA information provided by mirtarbase database.
188
miRTarBase ID miRNA Experiments Reference
MIRT028792 hsa-miR-26b-5p Microarray 19088304
MIRT051203 hsa-miR-16-5p CLASH 23622248
MIRT038229 hsa-miR-342-5p CLASH 23622248
MIRT649822 hsa-miR-1250-3p HITS-CLIP 23824327
MIRT649821 hsa-miR-150-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000502 Component Proteasome complex IDA 17323924
GO:0000502 Component Proteasome complex IEA
GO:0000502 Component Proteasome complex NAS 8811196, 29636472
GO:0003723 Function RNA binding HDA 22658674
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602706 9547 ENSG00000100764
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P62191
Protein name 26S proteasome regulatory subunit 4 (P26s4) (26S proteasome AAA-ATPase subunit RPT2) (Proteasome 26S subunit ATPase 1)
Protein function Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
PDB 5GJQ , 5GJR , 5L4G , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C , 7W3F
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16450 Prot_ATP_ID_OB 109 163 Proteasomal ATPase OB C-terminal domain Domain
PF00004 AAA 222 355 ATPase family associated with various cellular activities (AAA) Domain
PF17862 AAA_lid_3 377 421 AAA+ lid domain Domain
Sequence
MGQSQSGGHGPGGGKKDDKDKKKKYEPPVPTRVGKKKKKTKGPDAASKLPLVTPHTQCRL
KLLKLERIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH
AIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVL
MDDTDPLVTVMKVEKAP
QETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSG
GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPL
PDEKT
KKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK
K
SKENVLYKKQEGTPEGLYL
Sequence length 440
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Neurodevelopmental disorder with poor growth, spastic tetraplegia, and hearing loss Pathogenic rs2503963172 RCV002291329
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193920988 RCV000149136
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 36091041
Anemia Hemolytic Associate 36639418
Arthritis Rheumatoid Associate 39342401
Ataxia Telangiectasia Associate 19147735
Breast Neoplasms Associate 34329194
Diabetes Mellitus Type 2 Associate 39342401
Hypertension Associate 32664164
Ossification Heterotopic Associate 34612770
Prostatic Neoplasms Associate 22509301
Spondylitis Ankylosing Inhibit 34612770