Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5698
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 20S subunit beta 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMB9
Synonyms (NCBI Gene) Gene synonyms aliases	LMP2, PRAAS3, PRAAS6, PSMB6i, RING12, beta1i
Disease Acronyms (UniProt) Disease acronyms from UniProt database	PRAAS3, PRAAS6
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.	The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs369359789	G>A	Pathogenic	Missense variant, coding sequence variant

Show/Hide all(101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT683914	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT683913	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT683912	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT683911	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT683910	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT683909	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT683908	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT683907	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT683906	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT683905	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT683904	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683903	hsa-miR-6791-3p	HITS-CLIP	23313552
MIRT683902	hsa-miR-6829-3p	HITS-CLIP	23313552
MIRT683901	hsa-miR-23a-5p	HITS-CLIP	23313552
MIRT683900	hsa-miR-23b-5p	HITS-CLIP	23313552
MIRT683899	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT683898	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT683897	hsa-miR-5001-3p	HITS-CLIP	23313552
MIRT683896	hsa-miR-6836-3p	HITS-CLIP	23313552
MIRT683895	hsa-miR-498	HITS-CLIP	23313552
MIRT508793	hsa-miR-6732-5p	PAR-CLIP	23446348
MIRT508792	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT508791	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT508789	hsa-miR-1257	PAR-CLIP	23446348
MIRT508793	hsa-miR-6732-5p	PAR-CLIP	23446348
MIRT508792	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT508791	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT508789	hsa-miR-1257	PAR-CLIP	23446348
MIRT508790	hsa-miR-29b-2-5p	PAR-CLIP	23446348
MIRT508788	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT508787	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT683914	hsa-miR-216a-5p	HITS-CLIP	23313552
MIRT683913	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT683912	hsa-miR-6736-3p	HITS-CLIP	23313552
MIRT683911	hsa-miR-660-3p	HITS-CLIP	23313552
MIRT683910	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT683909	hsa-miR-6852-5p	HITS-CLIP	23313552
MIRT683908	hsa-miR-6742-3p	HITS-CLIP	23313552
MIRT683907	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT683906	hsa-miR-6787-3p	HITS-CLIP	23313552
MIRT683905	hsa-miR-4772-3p	HITS-CLIP	23313552
MIRT683904	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT683903	hsa-miR-6791-3p	HITS-CLIP	23313552
MIRT683902	hsa-miR-6829-3p	HITS-CLIP	23313552
MIRT683901	hsa-miR-23a-5p	HITS-CLIP	23313552
MIRT683900	hsa-miR-23b-5p	HITS-CLIP	23313552
MIRT683899	hsa-miR-1343-3p	HITS-CLIP	23313552
MIRT683898	hsa-miR-6783-3p	HITS-CLIP	23313552
MIRT683897	hsa-miR-5001-3p	HITS-CLIP	23313552
MIRT683896	hsa-miR-6836-3p	HITS-CLIP	23313552
MIRT683895	hsa-miR-498	HITS-CLIP	23313552
MIRT508793	hsa-miR-6732-5p	PAR-CLIP	23446348
MIRT508792	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT508791	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT508789	hsa-miR-1257	PAR-CLIP	23446348
MIRT508793	hsa-miR-6732-5p	PAR-CLIP	23446348
MIRT508792	hsa-miR-6798-5p	PAR-CLIP	23446348
MIRT508791	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT508789	hsa-miR-1257	PAR-CLIP	23446348
MIRT508790	hsa-miR-29b-2-5p	PAR-CLIP	23446348
MIRT508788	hsa-miR-659-3p	PAR-CLIP	23446348
MIRT508787	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT2602938	hsa-miR-1224-3p	CLIP-seq
MIRT2602939	hsa-miR-125a-5p	CLIP-seq
MIRT2602940	hsa-miR-125b	CLIP-seq
MIRT2602941	hsa-miR-1291	CLIP-seq
MIRT2602942	hsa-miR-328	CLIP-seq
MIRT2602943	hsa-miR-3663-3p	CLIP-seq
MIRT2602944	hsa-miR-3913-3p	CLIP-seq
MIRT2602945	hsa-miR-4266	CLIP-seq
MIRT2602946	hsa-miR-4287	CLIP-seq
MIRT2602947	hsa-miR-4319	CLIP-seq
MIRT2602948	hsa-miR-4469	CLIP-seq
MIRT2602949	hsa-miR-4685-3p	CLIP-seq
MIRT2602950	hsa-miR-4695-5p	CLIP-seq
MIRT2602951	hsa-miR-4732-3p	CLIP-seq
MIRT2602952	hsa-miR-4779	CLIP-seq
MIRT2602953	hsa-miR-489	CLIP-seq
MIRT2602954	hsa-miR-591	CLIP-seq
MIRT2602955	hsa-miR-670	CLIP-seq
MIRT2602938	hsa-miR-1224-3p	CLIP-seq
MIRT2602939	hsa-miR-125a-5p	CLIP-seq
MIRT2602940	hsa-miR-125b	CLIP-seq
MIRT2602941	hsa-miR-1291	CLIP-seq
MIRT2602942	hsa-miR-328	CLIP-seq
MIRT2602943	hsa-miR-3663-3p	CLIP-seq
MIRT2602944	hsa-miR-3913-3p	CLIP-seq
MIRT2602945	hsa-miR-4266	CLIP-seq
MIRT2602946	hsa-miR-4287	CLIP-seq
MIRT2602947	hsa-miR-4319	CLIP-seq
MIRT2602948	hsa-miR-4469	CLIP-seq
MIRT2602949	hsa-miR-4685-3p	CLIP-seq
MIRT2602950	hsa-miR-4695-5p	CLIP-seq
MIRT2602951	hsa-miR-4732-3p	CLIP-seq
MIRT2602952	hsa-miR-4779	CLIP-seq
MIRT2602953	hsa-miR-489	CLIP-seq
MIRT2688856	hsa-miR-520d-5p	CLIP-seq
MIRT2688857	hsa-miR-524-5p	CLIP-seq
MIRT2688858	hsa-miR-556-3p	CLIP-seq
MIRT2602954	hsa-miR-591	CLIP-seq
MIRT2602955	hsa-miR-670	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
IRF1	Activation	18694960
IRF1	Unknown	10764778;10921891;16703666;9632673
NFKB1	Unknown	18694960
RELA	Unknown	18694960
SEC14L2	Unknown	7699330
STAT1	Unknown	10764778;10921891;16703666;9632673

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	TAS	8666937
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	14733938, 16957778, 18985028, 20723761, 28514442, 30833792, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0005839	Component	Proteasome core complex	ISS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1990111	Component	Spermatoproteasome complex	ISS
GO:2000116	Process	Regulation of cysteine-type endopeptidase activity	IMP	26524591

MIM	HGNC	e!Ensembl
177045	9546	ENSG00000240065

Protein

UniProt ID

P28065

Protein name

Proteasome subunit beta type-9 (EC 3.4.25.1) (Low molecular mass protein 2) (Macropain chain 7) (Multicatalytic endopeptidase complex chain 7) (Proteasome chain 7) (Proteasome subunit beta-1i) (Really interesting new gene 12 protein)

Protein function

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH (PubMed:33727065, PubMed:34819510). The

PDB

6AVO , 6E5B , 7AWE , 7B12 , 9FST

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	17 → 198	Proteasome subunit	Domain

Sequence

MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHER
IYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMV
AGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIA
LAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Sequence length

219

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS
Psoriasis	Psoriasis	GWAS

Show/Hide Text Mining Associations (96)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Inhibit	14997933
Achalasia Addisonianism Alacrimia syndrome	Associate	36746983
Alveolitis Extrinsic Allergic	Associate	20153157
Arthritis	Associate	7763114
Arthritis Rheumatoid	Associate	32998980, 39342401
Asthma	Associate	32867763
Autoimmune Diseases	Associate	24040045
Axial osteomalacia	Associate	7763114
Breast Neoplasms	Stimulate	35037412
Breast Neoplasms	Associate	36746983, 36766731
Burkitt Lymphoma	Associate	25463610, 28465297, 35408790
Carcinogenesis	Associate	27993616
Carcinogenesis	Inhibit	37986152
Carcinoma Ductal	Associate	30909665
Carcinoma Pancreatic Ductal	Associate	34957503
Carcinoma Renal Cell	Associate	22705098
Carcinoma Squamous Cell	Inhibit	23024775
Cardiomyopathy infantile histiocytoid	Associate	22705098
Celiac Disease	Associate	28934294
Cholesteatoma	Associate	37762439
Colorectal Neoplasms	Associate	24040045, 34162701
Depressive Disorder Major	Associate	31305436
Dermatitis	Associate	27258892
Dermatomyositis	Associate	39447013
Diabetes Mellitus Type 1	Associate	7847389
Diabetes Mellitus Type 2	Stimulate	36527108
Diabetes Mellitus Type 2	Inhibit	39342401
Drug Related Side Effects and Adverse Reactions	Associate	32808978
Epstein Barr Virus Infections	Associate	10458773, 16148164, 24714353, 9746788
Erectile Dysfunction	Associate	25343742
Esophageal Squamous Cell Carcinoma	Associate	29073155
Focal cortical dysplasia of Taylor	Stimulate	27566410
Gastrointestinal Neoplasms	Associate	16855371
GATA2 Deficiency	Associate	20671118
Glioblastoma	Associate	16101128, 23526983
Glomerulonephritis IGA	Associate	34861820
Hereditary leiomyomatosis and renal cell cancer	Associate	7632957, 9746788
Hodgkin Disease	Associate	11241300, 16332968, 7632957, 7693972, 9746788, 9774558
Hyperoxia	Stimulate	29155844
Hypersensitivity Delayed	Stimulate	21821548
Ichthyosis Vulgaris	Associate	25548428
Infections	Stimulate	15207616
Infections	Associate	19002111, 23308294, 7933121
Infections	Inhibit	29462212
Infectious Mononucleosis	Associate	7933121
Leukemia Myeloid Acute	Associate	24056819, 24377540
Lupus Erythematosus Systemic	Associate	19167523
Lupus Nephritis	Associate	31638917
Lymphoma	Associate	9490694
Lymphoma B Cell	Associate	1710288
Lymphoma T Cell	Associate	23628820
Lymphoma T Cell Peripheral	Associate	8396685
Lymphoproliferative Disorders	Associate	21896011, 23346186
Melanoma	Associate	10079252, 23360169, 32060274, 9632673
Microscopic Polyangiitis	Associate	23690996, 28569178
Mitochondrial Diseases	Stimulate	37433777
Monoclonal Gammopathy of Undetermined Significance	Associate	20008301
Multiple Myeloma	Associate	24377540
Multiple Sclerosis	Inhibit	20174631
Myositis	Associate	25098831
Myositis Inclusion Body	Associate	37153570
Nasopharyngeal Carcinoma	Associate	11241300, 1313894, 14694109, 16332968, 18087217, 19881953, 21039050, 21821548, 22051182, 22837212, 24109232, 33771238, 34257379, 7693972, 8396685
Nasopharyngeal Neoplasms	Associate	21039050, 33771238
Neoplasm Metastasis	Associate	21039050, 27497761, 28639897
Neoplasm Metastasis	Inhibit	37986152
Neoplasms	Associate	11241300, 12836015, 15611290, 16101128, 16148164, 17609424, 18181098, 18694960, 19002111, 20671118, 21741845, 24040045, 24154688, 24344220, 25329802 View all (7 more)
Neoplasms	Inhibit	15265880, 16855371, 37986152
Niemann Pick Disease Type C	Associate	31554374
Non Muscle Invasive Bladder Neoplasms	Stimulate	40012053
Oncocytoma renal	Associate	22705098
Osteoporosis	Associate	32805449
Ovarian Neoplasms	Associate	22249249
Pancreatic Neoplasms	Associate	24040045
Parkinson Disease	Associate	27098790
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	24056819
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	27599459
Primary Myelofibrosis	Associate	32331228
Pyruvate Carboxylase Deficiency Disease	Associate	27497761
Retinoblastoma	Associate	14983503
Rheumatic Diseases	Associate	7763114
Seizures	Associate	30249265
Sjogren's Syndrome	Associate	16414974, 37153570
Spondylitis Ankylosing	Associate	22034108, 7763114
Stomach Neoplasms	Associate	19002111
Triple Negative Breast Neoplasms	Associate	36746983
Tuberculosis	Associate	37340462
Tuberculosis Multidrug Resistant	Associate	37340462
Tuberculosis Spinal	Associate	37340462
Tuberous Sclerosis	Stimulate	27566410
Urethral Neoplasms	Associate	19756593
Urinary Bladder Neoplasms	Inhibit	39716185
Uterine Cervical Dysplasia	Inhibit	23024775
Uterine Cervical Neoplasms	Associate	28639897
Uterine Cervical Neoplasms	Stimulate	37986152
Uveitis Anterior	Associate	7763114, 9306872
Vitiligo	Associate	25548428, 28129744

PSMB9 (proteasome 20S subunit beta 9)