Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5695
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 20S subunit beta 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMB7
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q33.3
Summary Summary of gene provided in NCBI Entrez Gene.	The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029924	hsa-miR-26b-5p	Microarray	19088304
MIRT040761	hsa-miR-18a-3p	CLASH	23622248
MIRT040313	hsa-miR-615-3p	CLASH	23622248
MIRT040313	hsa-miR-615-3p	CLASH	23622248
MIRT685675	hsa-miR-3194-5p	HITS-CLIP	23313552
MIRT685674	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT685673	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT685672	hsa-miR-3180-5p	HITS-CLIP	23313552
MIRT685675	hsa-miR-3194-5p	HITS-CLIP	23313552
MIRT685674	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT685673	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT685672	hsa-miR-3180-5p	HITS-CLIP	23313552
MIRT1270288	hsa-miR-1298	CLIP-seq
MIRT1270289	hsa-miR-219-1-3p	CLIP-seq
MIRT1270290	hsa-miR-4470	CLIP-seq
MIRT2079449	hsa-miR-197	CLIP-seq
MIRT2079450	hsa-miR-4691-3p	CLIP-seq
MIRT1270288	hsa-miR-1298	CLIP-seq
MIRT1270289	hsa-miR-219-1-3p	CLIP-seq
MIRT1270290	hsa-miR-4470	CLIP-seq
MIRT2079450	hsa-miR-4691-3p	CLIP-seq
MIRT2305755	hsa-miR-550b	CLIP-seq
MIRT2305756	hsa-miR-571	CLIP-seq

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	14733938, 17948026, 20723761, 28514442, 30833792
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0005839	Component	Proteasome core complex	ISS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016604	Component	Nuclear body	IDA
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
604030	9544	ENSG00000136930

Protein

UniProt ID

Q99436

Protein name

Proteasome subunit beta type-7 (EC 3.4.25.1) (Macropain chain Z) (Multicatalytic endopeptidase complex chain Z) (Proteasome subunit Z) (Proteasome subunit beta-2) (beta-2)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6HTB , 6HTC , 6HTD , 6HTP , 6HTR , 6HUB , 6HUC , 6HUQ , 6HUU , 6HUV , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	40 → 221	Proteasome subunit	Domain
PF12465	Pr_beta_C	235 → 271	Proteasome beta subunits C terminal	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at a low level in colonic mucosa. Up-regulated in colorectal cancer tissues. {ECO:0000269|PubMed:18549262}.

Sequence

MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGT
RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

Sequence length

277

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Atrial Fibrillation	Atrial Fibrillation	GWAS
Hypothyroidism	Hypothyroidism	GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	38176925
Breast Neoplasms	Associate	20010949
Carcinoma Hepatocellular	Associate	36062301
Carcinoma Renal Cell	Stimulate	35693739
Multiple Myeloma	Associate	32561655
Neoplasms	Associate	36761753

PSMB7 (proteasome 20S subunit beta 7)