PSMB7 (proteasome 20S subunit beta 7)

Gene

• Entrez ID: 5695
• Gene name: Proteasome 20S subunit beta 7
• Gene symbol: PSMB7
• Synonyms (NCBI Gene): -
• Chromosome: 9
• Chromosome location: 9q33.3
• Summary: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029924	hsa-miR-26b-5p	Microarray	19088304
MIRT040761	hsa-miR-18a-3p	CLASH	23622248
MIRT040313	hsa-miR-615-3p	CLASH	23622248
MIRT040313	hsa-miR-615-3p	CLASH	23622248
MIRT685675	hsa-miR-3194-5p	HITS-CLIP	23313552
MIRT685674	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT685673	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT685672	hsa-miR-3180-5p	HITS-CLIP	23313552
MIRT685675	hsa-miR-3194-5p	HITS-CLIP	23313552
MIRT685674	hsa-miR-520a-5p	HITS-CLIP	23313552
MIRT685673	hsa-miR-525-5p	HITS-CLIP	23313552
MIRT685672	hsa-miR-3180-5p	HITS-CLIP	23313552
MIRT1270288	hsa-miR-1298	CLIP-seq
MIRT1270289	hsa-miR-219-1-3p	CLIP-seq
MIRT1270290	hsa-miR-4470	CLIP-seq
MIRT2079449	hsa-miR-197	CLIP-seq
MIRT2079450	hsa-miR-4691-3p	CLIP-seq
MIRT1270288	hsa-miR-1298	CLIP-seq
MIRT1270289	hsa-miR-219-1-3p	CLIP-seq
MIRT1270290	hsa-miR-4470	CLIP-seq
MIRT2079450	hsa-miR-4691-3p	CLIP-seq
MIRT2305755	hsa-miR-550b	CLIP-seq
MIRT2305756	hsa-miR-571	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0004175	Function	Endopeptidase activity	IBA
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	14733938, 16990800, 17948026, 20723761, 28514442, 30833792, 31473102, 33961781, 35271311
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	34711951
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34711951
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IDA	34711951
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0005929	Component	Cilium	IDA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019774	Component	Proteasome core complex, beta-subunit complex	IBA
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 604030
• HGNC: 9544
• e!Ensembl: ENSG00000136930

Protein

• UniProt ID: Q99436
• Protein name: Proteasome subunit beta type-7 (EC 3.4.25.1) (Macropain chain Z) (Multicatalytic endopeptidase complex chain Z) (Proteasome subunit Z) (Proteasome subunit beta-2) (beta-2)
• Protein function: Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with
• PDB: 4R3O, 4R67, 5A0Q, 5GJQ, 5GJR, 5L4G, 5LE5, 5LEX, 5LEY, 5LEZ, 5LF0, 5LF1, 5LF3, 5LF4, 5LF6, 5LF7, 5LN3, 5M32, 5T0C, 5T0G, 5T0H, 5T0I, 5T0J, 5VFO, 5VFP, 5VFQ, 5VFR, 5VFS, 5VFT, 5VFU, 6HTB, 6HTC, 6HTD, 6HTP, 6HTR, 6HUB, 6HUC, 6HUQ, 6HUU, 6HUV, 6KWY, 6MSB, 6MSD, 6MSE, 6MSG, 6MSH, 6MSJ, 6MSK, 6R70, 6REY, 6RGQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00227	Proteasome	40 → 221	Proteasome subunit	Domain
  PF12465	Pr_beta_C	235 → 271	Proteasome beta subunits C terminal	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at a low level in colonic mucosa. Up-regulated in colorectal cancer tissues. {ECO:0000269|PubMed:18549262}.
• Sequence:

  MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGAD
  TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVV
  TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
  FEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGT
  RLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS

• Sequence length: 277