Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5694
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 20S subunit beta 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMB6
Synonyms (NCBI Gene) Gene synonyms aliases	DELTA, LMPY
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Show/Hide all(58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049356	hsa-miR-92a-3p	CLASH	23622248
MIRT048307	hsa-miR-107	CLASH	23622248
MIRT038619	hsa-miR-185-3p	CLASH	23622248
MIRT2079448	hsa-miR-4477a	CLIP-seq
MIRT2305739	hsa-miR-137	CLIP-seq
MIRT2305740	hsa-miR-153	CLIP-seq
MIRT2305741	hsa-miR-25	CLIP-seq
MIRT2305742	hsa-miR-28-3p	CLIP-seq
MIRT2305743	hsa-miR-32	CLIP-seq
MIRT2305744	hsa-miR-363	CLIP-seq
MIRT2305745	hsa-miR-367	CLIP-seq
MIRT2305746	hsa-miR-448	CLIP-seq
MIRT2305747	hsa-miR-450b-5p	CLIP-seq
MIRT2305748	hsa-miR-4711-5p	CLIP-seq
MIRT2305749	hsa-miR-4761-3p	CLIP-seq
MIRT2305750	hsa-miR-507	CLIP-seq
MIRT2305751	hsa-miR-513a-3p	CLIP-seq
MIRT2305752	hsa-miR-557	CLIP-seq
MIRT2305753	hsa-miR-92a	CLIP-seq
MIRT2305754	hsa-miR-92b	CLIP-seq
MIRT2305739	hsa-miR-137	CLIP-seq
MIRT2305740	hsa-miR-153	CLIP-seq
MIRT2602936	hsa-miR-1915	CLIP-seq
MIRT2305741	hsa-miR-25	CLIP-seq
MIRT2305742	hsa-miR-28-3p	CLIP-seq
MIRT2305743	hsa-miR-32	CLIP-seq
MIRT2305744	hsa-miR-363	CLIP-seq
MIRT2305745	hsa-miR-367	CLIP-seq
MIRT2079448	hsa-miR-4477a	CLIP-seq
MIRT2305746	hsa-miR-448	CLIP-seq
MIRT2305747	hsa-miR-450b-5p	CLIP-seq
MIRT2305748	hsa-miR-4711-5p	CLIP-seq
MIRT2602937	hsa-miR-4726-3p	CLIP-seq
MIRT2305749	hsa-miR-4761-3p	CLIP-seq
MIRT2305750	hsa-miR-507	CLIP-seq
MIRT2305751	hsa-miR-513a-3p	CLIP-seq
MIRT2305752	hsa-miR-557	CLIP-seq
MIRT2305753	hsa-miR-92a	CLIP-seq
MIRT2305754	hsa-miR-92b	CLIP-seq
MIRT2305739	hsa-miR-137	CLIP-seq
MIRT2305740	hsa-miR-153	CLIP-seq
MIRT2602936	hsa-miR-1915	CLIP-seq
MIRT2305741	hsa-miR-25	CLIP-seq
MIRT2305742	hsa-miR-28-3p	CLIP-seq
MIRT2305743	hsa-miR-32	CLIP-seq
MIRT2305744	hsa-miR-363	CLIP-seq
MIRT2305745	hsa-miR-367	CLIP-seq
MIRT2079448	hsa-miR-4477a	CLIP-seq
MIRT2305746	hsa-miR-448	CLIP-seq
MIRT2305747	hsa-miR-450b-5p	CLIP-seq
MIRT2305748	hsa-miR-4711-5p	CLIP-seq
MIRT2602937	hsa-miR-4726-3p	CLIP-seq
MIRT2305749	hsa-miR-4761-3p	CLIP-seq
MIRT2305750	hsa-miR-507	CLIP-seq
MIRT2305751	hsa-miR-513a-3p	CLIP-seq
MIRT2305752	hsa-miR-557	CLIP-seq
MIRT2305753	hsa-miR-92a	CLIP-seq
MIRT2305754	hsa-miR-92b	CLIP-seq

Show/Hide all(44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0004175	Function	Endopeptidase activity	NAS	8066462
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	14733938, 17948026, 28514442, 32296183, 32814053
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0005839	Component	Proteasome core complex	ISS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS

MIM	HGNC	e!Ensembl
600307	9543	ENSG00000142507

Protein

UniProt ID

P28072

Protein name

Proteasome subunit beta type-6 (EC 3.4.25.1) (Macropain delta chain) (Multicatalytic endopeptidase complex delta chain) (Proteasome delta chain) (Proteasome subunit Y) (Proteasome subunit beta-1) (beta-1)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7LXV , 7NAN , 7NAO , 7NAP , 7NAQ , 7NHT , 7PG9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	31 → 213	Proteasome subunit	Domain

Sequence

MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGTTIMAVQFDGGVVLGADSRTTTGSYI
ANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEM
CYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREG
MTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFAVATLPPA

Sequence length

239

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Systemic lupus erythematosus	Systemic lupus erythematosus			GWAS

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	34721732
Arthritis Rheumatoid	Associate	39342401
Cystic Fibrosis	Associate	32927759
Diabetes Mellitus Type 2	Associate	39342401
Lung Neoplasms	Associate	24685647
Multiple Myeloma	Associate	32561655
Neoplasms	Inhibit	31108950
Neoplasms	Associate	34721732

PSMB6 (proteasome 20S subunit beta 6)