Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5699
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 20S subunit beta 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMB10
Synonyms (NCBI Gene) Gene synonyms aliases	IMD121, LMP10, MECL1, PRAAS5, beta2i
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
IRF1	Unknown	18694960
NFKB1	Unknown	18694960
RELA	Unknown	18694960

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	TAS	9551082
GO:0000902	Process	Cell morphogenesis	IEA
GO:0004175	Function	Endopeptidase activity	IBA
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	14733938, 21516116, 25416956, 28514442, 31515488, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006508	Process	Proteolysis	IEA
GO:0006959	Process	Humoral immune response	TAS	8666937
GO:0008233	Function	Peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019774	Component	Proteasome core complex, beta-subunit complex	IBA
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0042098	Process	T cell proliferation	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:1990111	Component	Spermatoproteasome complex	IEA
GO:1990111	Component	Spermatoproteasome complex	ISS

MIM	HGNC	e!Ensembl
176847	9538	ENSG00000205220

Protein

UniProt ID

P40306

Protein name

Proteasome subunit beta type-10 (EC 3.4.25.1) (Low molecular mass protein 10) (Macropain subunit MECl-1) (Multicatalytic endopeptidase complex subunit MECl-1) (Proteasome MECl-1) (Proteasome subunit beta-2i)

Protein function

The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent pr

PDB

6AVO , 6E5B , 6HV3 , 6HV4 , 6HV5 , 6HV7 , 6HVA , 6HVR , 6HVS , 6HVT , 6HVU , 6HVV , 6HVW , 7AWE , 7B12 , 9FSV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	36 → 217	Proteasome subunit	Domain
PF12465	Pr_beta_C	231 → 267	Proteasome beta subunits C terminal	Family

Sequence

MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRAT
NDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTR
ILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDR
FQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGR
YHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

Sequence length

273

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Immunodeficiency	immunodeficiency 121 with autoinflammation	N/A	N/A	GenCC
Proteasome-associated autoinflammatory syndrome	proteasome-associated autoinflammatory syndrome 5	N/A	N/A	GenCC

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Inhibit	14997933
Alzheimer Disease	Stimulate	21252911
Aortic Aneurysm Abdominal	Associate	27157464
Arthritis Rheumatoid	Associate	39342401
Autoimmune Diseases of the Nervous System	Associate	16414974
Breast Neoplasms	Associate	29685151
Burkitt Lymphoma	Associate	28465297
Carcinoma Hepatocellular	Associate	21256843
chronic atypical neutrophilic dermatosis with lipodystrophy and elevated temperature	Associate	37600812
Death	Associate	38503300
Diabetes Mellitus Type 1	Associate	37581620
Diabetes Mellitus Type 2	Associate	39342401
Glioblastoma	Associate	16101128
Inflammatory Bowel Diseases	Associate	22710419
Leiomyosarcoma	Associate	39249578
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26474455
Leukemia Myeloid Acute	Associate	24056819
Liposarcoma	Associate	39249578
Liposarcoma Myxoid	Associate	39249578
Lupus Erythematosus Systemic	Associate	1426288
Monoclonal Gammopathy of Undetermined Significance	Associate	20008301
Myositis	Associate	25098831
Neoplasms	Associate	12836015, 18181098, 36700205
Neoplasms	Inhibit	15265880
Neoplasms	Stimulate	16101128
Non Muscle Invasive Bladder Neoplasms	Stimulate	40012053
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	24056819
Primary Myelofibrosis	Associate	32331228
Severe Combined Immunodeficiency	Associate	38503300
Urethral Neoplasms	Associate	19756593
Uterine Cervical Neoplasms	Associate	29745858

PSMB10 (proteasome 20S subunit beta 10)