Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5689
Gene name Gene Name - the full gene name approved by the HGNC.	Proteasome 20S subunit beta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSMB1
Synonyms (NCBI Gene) Gene synonyms aliases	HC5, NEDMHAL, PMSB1, PSC5
Disease Acronyms (UniProt) Disease acronyms from UniProt database	NEDMHAL
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q27
Summary Summary of gene provided in NCBI Entrez Gene.	The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049066	hsa-miR-92a-3p	CLASH	23622248
MIRT047743	hsa-miR-10a-5p	CLASH	23622248
MIRT046038	hsa-miR-125b-5p	CLASH	23622248
MIRT1270091	hsa-miR-3973	CLIP-seq
MIRT1270092	hsa-miR-548k	CLIP-seq
MIRT1270093	hsa-miR-582-5p	CLIP-seq

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000209	Process	Protein polyubiquitination	TAS
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0002479	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS
GO:0004175	Function	Endopeptidase activity	IBA	21873635
GO:0004298	Function	Threonine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 17948026, 20723761, 25416956, 25599644, 25959826, 28514442, 29568061, 29636472, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IBA	21873635
GO:0005839	Component	Proteasome core complex	ISS
GO:0006521	Process	Regulation of cellular amino acid metabolic process	TAS
GO:0010499	Process	Proteasomal ubiquitin-independent protein catabolic process	IBA	21873635
GO:0010972	Process	Negative regulation of G2/M transition of mitotic cell cycle	TAS
GO:0016032	Process	Viral process	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0019774	Component	Proteasome core complex, beta-subunit complex	ISS
GO:0031145	Process	Anaphase-promoting complex-dependent catabolic process	TAS
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	TAS
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038061	Process	NIK/NF-kappaB signaling	TAS
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	21873635
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	TAS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043687	Process	Post-translational protein modification	TAS
GO:0050852	Process	T cell receptor signaling pathway	TAS
GO:0055085	Process	Transmembrane transport	TAS
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	TAS
GO:0061418	Process	Regulation of transcription from RNA polymerase II promoter in response to hypoxia	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	TAS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	TAS
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	TAS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	TAS
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
602017	9537	ENSG00000008018

Protein

UniProt ID

P20618

Protein name

Proteasome subunit beta type-1 (Macropain subunit C5) (Multicatalytic endopeptidase complex subunit C5) (Proteasome component C5) (Proteasome gamma chain) (Proteasome subunit beta-6) (beta-6)

Protein function

Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. As

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5L5B , 5L5D , 5L5E , 5L5F , 5L5H , 5L5I , 5L5J , 5L5O , 5L5P , 5L5Q , 5L5R , 5L5S , 5L5T , 5L5U , 5L5V , 5L5W , 5L5X , 5L5Y , 5L5Z , 5L60 , 5L61 , 5L62 , 5L63 , 5L64 , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M2B , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	34 → 226	Proteasome subunit	Domain

Sequence

MLSSTAMYSAPGRDLGMEPHRAAGPLQLRFSPYVFNGGTILAIAGEDFAIVASDTRLSEG
FSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAML
STILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQ
VGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRK
D

Sequence length

241

Interactions

View interactions

PSMB1 (proteasome 20S subunit beta 1)