Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11168
Gene name Gene Name - the full gene name approved by the HGNC.	PC4 and SRSF1 interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PSIP1
Synonyms (NCBI Gene) Gene synonyms aliases	DFS70, LEDGF, PAIP, PSIP2, p52, p75
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p22.3

Show/Hide all(80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016293	hsa-miR-193b-3p	Microarray	20304954
MIRT019773	hsa-miR-375	Microarray	20215506
MIRT020538	hsa-miR-155-5p	Proteomics	18668040
MIRT023558	hsa-miR-1-3p	Proteomics	18668040
MIRT023558	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT016293	hsa-miR-193b-3p	CLASH	23622248
MIRT020538	hsa-miR-155-5p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23028330
MIRT020538	hsa-miR-155-5p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23028330
MIRT020538	hsa-miR-155-5p	ChIP-seq, Luciferase reporter assay, Western blot	26497687
MIRT1269756	hsa-miR-1231	CLIP-seq
MIRT1269757	hsa-miR-1299	CLIP-seq
MIRT1269758	hsa-miR-1323	CLIP-seq
MIRT1269759	hsa-miR-2276	CLIP-seq
MIRT1269760	hsa-miR-3143	CLIP-seq
MIRT1269761	hsa-miR-3148	CLIP-seq
MIRT1269762	hsa-miR-346	CLIP-seq
MIRT1269763	hsa-miR-365	CLIP-seq
MIRT1269764	hsa-miR-4288	CLIP-seq
MIRT1269765	hsa-miR-433	CLIP-seq
MIRT1269766	hsa-miR-4420	CLIP-seq
MIRT1269767	hsa-miR-4432	CLIP-seq
MIRT1269768	hsa-miR-4659a-3p	CLIP-seq
MIRT1269769	hsa-miR-4659b-3p	CLIP-seq
MIRT1269770	hsa-miR-4691-3p	CLIP-seq
MIRT1269771	hsa-miR-4772-3p	CLIP-seq
MIRT1269772	hsa-miR-499-5p	CLIP-seq
MIRT1269773	hsa-miR-518a-5p	CLIP-seq
MIRT1269774	hsa-miR-527	CLIP-seq
MIRT1269775	hsa-miR-543	CLIP-seq
MIRT1269776	hsa-miR-548o	CLIP-seq
MIRT1269777	hsa-miR-632	CLIP-seq
MIRT1269778	hsa-miR-654-3p	CLIP-seq
MIRT1269779	hsa-miR-875-3p	CLIP-seq
MIRT1269780	hsa-miR-200b	CLIP-seq
MIRT1269781	hsa-miR-200c	CLIP-seq
MIRT1269782	hsa-miR-2053	CLIP-seq
MIRT1269783	hsa-miR-217	CLIP-seq
MIRT1269784	hsa-miR-3667-5p	CLIP-seq
MIRT1269785	hsa-miR-374c	CLIP-seq
MIRT1269786	hsa-miR-384	CLIP-seq
MIRT1269787	hsa-miR-409-3p	CLIP-seq
MIRT1269788	hsa-miR-4274	CLIP-seq
MIRT1269789	hsa-miR-429	CLIP-seq
MIRT1269790	hsa-miR-4328	CLIP-seq
MIRT1269791	hsa-miR-4418	CLIP-seq
MIRT1269792	hsa-miR-4519	CLIP-seq
MIRT1269793	hsa-miR-4528	CLIP-seq
MIRT1269794	hsa-miR-509-3-5p	CLIP-seq
MIRT1269795	hsa-miR-509-5p	CLIP-seq
MIRT1269796	hsa-miR-548c-3p	CLIP-seq
MIRT1269797	hsa-miR-562	CLIP-seq
MIRT1269798	hsa-miR-569	CLIP-seq
MIRT1269799	hsa-miR-655	CLIP-seq
MIRT1269800	hsa-miR-885-5p	CLIP-seq
MIRT1552660	hsa-miR-607	CLIP-seq
MIRT2079285	hsa-miR-1298	CLIP-seq
MIRT2079286	hsa-miR-409-5p	CLIP-seq
MIRT2079287	hsa-miR-582-5p	CLIP-seq
MIRT2079288	hsa-miR-659	CLIP-seq
MIRT2457307	hsa-miR-1253	CLIP-seq
MIRT1269758	hsa-miR-1323	CLIP-seq
MIRT2457308	hsa-miR-139-3p	CLIP-seq
MIRT1269760	hsa-miR-3143	CLIP-seq
MIRT2457309	hsa-miR-362-5p	CLIP-seq
MIRT2457310	hsa-miR-3663-5p	CLIP-seq
MIRT2457311	hsa-miR-4272	CLIP-seq
MIRT2457312	hsa-miR-4698	CLIP-seq
MIRT2457313	hsa-miR-4725-5p	CLIP-seq
MIRT2457314	hsa-miR-4803	CLIP-seq
MIRT2457315	hsa-miR-500b	CLIP-seq
MIRT2457316	hsa-miR-501-5p	CLIP-seq
MIRT2457317	hsa-miR-504	CLIP-seq
MIRT1269776	hsa-miR-548o	CLIP-seq
MIRT2457318	hsa-miR-587	CLIP-seq
MIRT1552660	hsa-miR-607	CLIP-seq
MIRT2457319	hsa-miR-664	CLIP-seq
MIRT1269763	hsa-miR-365	CLIP-seq
MIRT1269766	hsa-miR-4420	CLIP-seq
MIRT1269767	hsa-miR-4432	CLIP-seq
MIRT1269772	hsa-miR-499-5p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
HDAC1	Unknown	23386123
SP1	Unknown	22019592;23386123

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000395	Process	MRNA 5'-splice site recognition	IDA	9885563
GO:0000791	Component	Euchromatin	ISS
GO:0000792	Component	Heterochromatin	IDA	12796494
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	20974633
GO:0003713	Function	Transcription coactivator activity	IDA	9822615, 9885563
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	9885563, 17137594, 21156026, 22748127, 22773103, 22872640, 25082813, 25305204, 29997176
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12796494
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	9885563
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	11512661
GO:0005829	Component	Cytosol	TAS
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	ISS
GO:0009408	Process	Response to heat	IEA
GO:0009408	Process	Response to heat	ISS
GO:0034399	Component	Nuclear periphery	IDA	11512661
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	9822615, 9885563
GO:0097100	Function	Supercoiled DNA binding	ISS
GO:0140297	Function	DNA-binding transcription factor binding	IDA	9822615

MIM	HGNC	e!Ensembl
603620	9527	ENSG00000164985

Protein

UniProt ID

O75475

Protein name

PC4 and SFRS1-interacting protein (CLL-associated antigen KW-7) (Dense fine speckles 70 kDa protein) (DFS 70) (Lens epithelium-derived growth factor) (Transcriptional coactivator p75/p52)

Protein function

Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell

PDB

1Z9E , 2B4J , 2M16 , 2MSR , 2MTN , 2N3A , 3F9K , 3HPG , 3HPH , 3U88 , 3ZEH , 4FU6 , 5N88 , 5OYM , 5YI9 , 6EMO , 6EMP , 6EMQ , 6EMR , 6S01 , 6TRJ , 6TVM , 6ZV0 , 7OUF , 7OUG , 7OUH , 7PEL , 7Z1Z , 8CBN , 8CBQ , 8PC5 , 8PC6 , 8PEO , 8PEP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00855	PWWP	5 → 89	PWWP domain	Domain
PF11467	LEDGF	349 → 450	Lens epithelium-derived growth factor (LEDGF)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventr

Sequence

MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFP
YSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKE
DTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKR
GRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKE
EDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRR
NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIK
NSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLY
NKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNG
GSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN

Sequence length

530

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (54)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Spontaneous	Associate	33133072
Agnosia	Associate	24604027
Anemia Refractory	Associate	19692701
Arthritis	Associate	19490633
Arthritis Juvenile	Associate	33133072
Arthritis Psoriatic	Associate	20631726
Autoimmune Diseases	Associate	20484370, 22275515, 26771192
Autoimmune Diseases	Stimulate	37047137
Breast Neoplasms	Associate	28633434
Carcinogenesis	Stimulate	24604027
Carcinoid Tumor	Associate	24670920
Carcinoma Ductal	Stimulate	28633434
Carcinoma Non Small Cell Lung	Associate	35368958
Carcinoma Ovarian Epithelial	Associate	26840454
Cell Transformation Neoplastic	Associate	22647853, 3080434
Cell Transformation Viral	Associate	20484370
Congenital thrombotic disease due to Protein C deficiency	Associate	22647853
Esophageal Squamous Cell Carcinoma	Associate	30854807
Gallbladder Neoplasms	Associate	20353905
Glioblastoma	Associate	39216044
Hematologic Neoplasms	Associate	30848074
HIV Infections	Associate	21681054, 22275515, 22479480, 23226247, 25047784, 25231459, 26771192, 27216501, 30787394, 32426500
HTLV I Infections	Associate	16987986, 18174227
Hyperglycemia	Stimulate	21386984
Infections	Inhibit	24482297
Infections	Associate	27783955
Inflammation	Associate	22275515
Leukemia	Associate	11737860, 22019592
Leukemia Biphenotypic Acute	Associate	20484370, 29997176
Leukemia Myeloid Acute	Associate	11737860, 20484370, 24634210, 30848074
Leukemia Myeloid Acute	Stimulate	17451600
Lymphoma Large B Cell Diffuse	Associate	33749163
Muscular Dystrophy Congenital with Rapid Progression	Associate	25047784
Necrosis	Inhibit	26771192
Neoplasm Metastasis	Associate	28633434
Neoplasms	Associate	18708362, 19667409, 20484370, 20631726, 21796653, 22275515, 2304898, 24604027, 3080434, 37047137, 37626856
Neoplasms	Stimulate	26771192
Neuroendocrine Tumors	Associate	27994516
Obesity	Associate	26449484
Osteosarcoma	Associate	34922489, 38225273
Ovarian Neoplasms	Associate	26840454
Pancreatic Neoplasms	Associate	21386984
Peripheral Nerve Injuries	Associate	9669765
Persistent Infection	Associate	25047784
Prostatic Hyperplasia	Associate	37047137, 37501430
Prostatic Neoplasms	Associate	18708362, 21796653, 22275515, 22647853, 24860838, 30305646, 37626856
Prostatic Neoplasms	Inhibit	19715609
Prostatic Neoplasms	Stimulate	26771192
Prostatitis	Stimulate	18708362
Psoriasis	Associate	22019592
Rheumatic Diseases	Associate	29732925, 33133072
Rheumatic Diseases	Inhibit	30778125
Synovitis	Associate	19490633
Triple Negative Breast Neoplasms	Stimulate	28633434

PSIP1 (PC4 and SRSF1 interacting protein 1)