Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5590
Gene name Gene Name - the full gene name approved by the HGNC.	Protein kinase C zeta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRKCZ
Synonyms (NCBI Gene) Gene synonyms aliases	PKC-ZETA, PKC2
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.33
Summary Summary of gene provided in NCBI Entrez Gene.	Protein kinase C (PKC) zeta is a member of the PKC family of serine/threonine kinases which are involved in a variety of cellular processes such as proliferation, differentiation and secretion. Unlike the classical PKC isoenzymes which are calcium-depende

Show/Hide all(12)

miRTarBase ID	miRNA	Experiments
MIRT2457169	hsa-miR-1207-5p	CLIP-seq
MIRT2457170	hsa-miR-127-3p	CLIP-seq
MIRT2457171	hsa-miR-15a	CLIP-seq
MIRT2457172	hsa-miR-15b	CLIP-seq
MIRT2457173	hsa-miR-16	CLIP-seq
MIRT2457174	hsa-miR-195	CLIP-seq
MIRT2457175	hsa-miR-3943	CLIP-seq
MIRT2457176	hsa-miR-424	CLIP-seq
MIRT2457177	hsa-miR-4269	CLIP-seq
MIRT2457178	hsa-miR-4313	CLIP-seq
MIRT2457179	hsa-miR-4763-3p	CLIP-seq
MIRT2457180	hsa-miR-497	CLIP-seq

Show/Hide all(80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IEA
GO:0004672	Function	Protein kinase activity	IDA	10770950
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	15069075
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	EXP	12391145
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	10831594, 11260256, 11755531, 12893243, 14676191, 15707389, 16189514, 16792529, 17057644, 17203073, 17313651, 17350623, 17588663, 18190796, 18650932, 21829704, 22939624, 24375676, 25011391, 25852190, 26583432, 27040869, 27107012, 28514442, 31980649, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	7925449
GO:0005768	Component	Endosome	IEA
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7925449
GO:0005911	Component	Cell-cell junction	IDA	20332120
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005929	Component	Cilium	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10770950, 17313651
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	8224878
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7925449
GO:0016301	Function	Kinase activity	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030010	Process	Establishment of cell polarity	ISS
GO:0030054	Component	Cell junction	TAS
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	15069075
GO:0031982	Component	Vesicle	IDA	17313651
GO:0031982	Component	Vesicle	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	ISS
GO:0032736	Process	Positive regulation of interleukin-13 production	IEA
GO:0032736	Process	Positive regulation of interleukin-13 production	ISS
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IBA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035748	Component	Myelin sheath abaxonal region	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	10770953
GO:0043203	Component	Axon hillock	IEA
GO:0043560	Function	Insulin receptor substrate binding	IDA	15069075
GO:0045179	Component	Apical cortex	IEA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	ISS
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	IEA
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	ISS
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IMP	15069075
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	ISS
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070160	Component	Tight junction	NAS	11257119
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	11035106
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120157	Component	PAR polarity complex	ISS
GO:1990138	Process	Neuron projection extension	IEA
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	ISS
GO:2000553	Process	Positive regulation of T-helper 2 cell cytokine production	IEA
GO:2000553	Process	Positive regulation of T-helper 2 cell cytokine production	ISS

MIM	HGNC	e!Ensembl
176982	9412	ENSG00000067606

Protein

UniProt ID

Q05513

Protein name

Protein kinase C zeta type (EC 2.7.11.13) (nPKC-zeta)

Protein function

Calcium- and diacylglycerol-independent serine/threonine-protein kinase that functions in phosphatidylinositol 3-kinase (PI3K) pathway and mitogen-activated protein (MAP) kinase cascade, and is involved in NF-kappa-B activation, mitogenic signal

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00564	PB1	15 → 98	PB1 domain	Domain
PF00130	C1_1	131 → 183	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00069	Pkinase	252 → 518	Protein kinase domain	Domain
PF00433	Pkinase_C	539 → 580	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, and to a lesser extent in lung, kidney and testis.

Sequence

MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC
RKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV

Sequence length

592

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypertension	Ischemic stroke in hypertension	N/A	N/A	GWAS

Show/Hide Text Mining Associations (71)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Coronary Syndrome	Associate	34151742
Adenocarcinoma of Lung	Associate	31412817
Adenoma	Inhibit	16940160
Alzheimer Disease	Associate	18336728, 37833700
Breast Neoplasms	Associate	24603690, 26218882, 36200956, 37890607, 40571311
Calcinosis Cutis	Inhibit	26218882
Cancer Pain	Associate	39272077
Carcinogenesis	Inhibit	16940160
Carcinogenesis	Associate	22333579, 22475628
Carcinoma Renal Cell	Associate	22475628, 9346879, 9756852
Cardiomyopathies	Associate	24454898
Cardiovascular Diseases	Associate	39198424
Cell Transformation Neoplastic	Associate	21886838
Chondrosarcoma	Associate	35017658
Chromosomal Instability	Associate	29520890
Chromosome 1p36 Deletion Syndrome	Inhibit	24839341
Colorectal Neoplasms	Associate	21946537, 26711256, 30504065, 33434524
Colorectal Neoplasms	Inhibit	29520890
Diabetes Mellitus Type 2	Associate	12970910, 15285019, 26386696, 28934129, 31065010
Diabetic Nephropathies	Associate	17327498
Drug Hypersensitivity	Inhibit	23004934
Drug Hypersensitivity	Associate	34063174
Drug Related Side Effects and Adverse Reactions	Associate	12105221
Eczema	Inhibit	23004934
Epiphyseal dysplasia multiple 1	Associate	18050214
Femur Head Necrosis	Associate	27911275
Glioblastoma	Associate	19187446, 29642372
Gout	Associate	33493135
Hepatitis B	Associate	40571311
Hyperandrogenism	Associate	22390153
Immunologic Deficiency Syndromes	Associate	28159873
Inflammation	Associate	33493135
Inflammatory Breast Neoplasms	Associate	29485045
Insulin Resistance	Inhibit	22390153
Insulin Resistance	Stimulate	26386696
Kidney Neoplasms	Inhibit	22475628
Leukemia	Associate	21946537
Leukemia Biphenotypic Acute	Stimulate	24990612
Leukemia Myeloid	Associate	12139760
Leukemia Myeloid Acute	Associate	11739185
Lung Neoplasms	Associate	28592245, 30458782
Lupus Erythematosus Systemic	Inhibit	15379867
Lymphoma Follicular	Stimulate	17855629
Melanoma	Associate	29048609, 36716920
Multiple Myeloma	Associate	12786795
Nasopharyngeal Carcinoma	Associate	11284734
Nasopharyngeal Neoplasms	Associate	11284734
Neoplasm Metastasis	Associate	25915428, 36716920
Neoplasm Metastasis	Inhibit	28631559
Neoplasms	Stimulate	16508638, 9916928
Neoplasms	Associate	21281788, 21390241, 22333579, 22475628, 23340843, 24603690, 25874946, 25915428, 28631559, 30504065, 31412817, 8434650, 9756852
Neoplasms	Inhibit	24990612, 26218882
Obesity	Associate	26386696
Ovarian Diseases	Associate	25874946
Ovarian Neoplasms	Associate	23340843, 25874946
Pancreatic Neoplasms	Associate	14604996, 25915428
Polycystic Ovary Syndrome	Associate	22390153
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	21946537
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24990612
Prostatic Hyperplasia	Associate	26885621
Prostatic Neoplasms	Associate	22644296, 25559363, 26885621, 9916928
Prostatic Neoplasms	Inhibit	28631559
Prostatitis	Associate	22644296
Psoriasis	Associate	18385757
Pulmonary Disease Chronic Obstructive	Associate	38203236
Sarcoma	Associate	21390241
Squamous Cell Carcinoma of Head and Neck	Associate	21281788
Stomach Diseases	Associate	31482734
Tertiary Lymphoid Structures	Stimulate	24603690
Uterine Cervical Neoplasms	Associate	29610452
Zellweger Syndrome	Associate	7535766

PRKCZ (protein kinase C zeta)