Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	51422
Gene name Gene Name - the full gene name approved by the HGNC.	Protein kinase AMP-activated non-catalytic subunit gamma 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRKAG2
Synonyms (NCBI Gene) Gene synonyms aliases	AAKG, AAKG2, CMH6, H91620p, WPWS
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CMH6
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q36.1
Summary Summary of gene provided in NCBI Entrez Gene.	AMP-activated protein kinase (AMPK) is a heterotrimeric protein composed of a catalytic alpha subunit, a noncatalytic beta subunit, and a noncatalytic regulatory gamma subunit. Various forms of each of these subunits exist, encoded by different genes. AMP

Show/Hide all(27)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28938173	G>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs61746358	G>A,T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Genic upstream transcript variant, 5 prime UTR variant, missense variant, synonymous variant, coding sequence variant
rs116541276	T>C	Likely-benign, benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs121908987	C>A,G,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs121908988	T>C	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs121908989	T>A,C	Pathogenic	Missense variant, coding sequence variant
rs121908990	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs121908991	C>A,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs139579816	A>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant, genic upstream transcript variant, 5 prime UTR variant
rs144857453	C>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Genic upstream transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs193922697	G>A,T	Likely-pathogenic, pathogenic	Synonymous variant, missense variant, coding sequence variant
rs201240745	G>C	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Intron variant, 5 prime UTR variant, missense variant, coding sequence variant, genic upstream transcript variant, upstream transcript variant
rs201878539	G>A	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs201953758	C>T	Conflicting-interpretations-of-pathogenicity, likely-benign	5 prime UTR variant, missense variant, coding sequence variant, genic upstream transcript variant
rs267606976	A>G	Likely-pathogenic, pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs267606977	T>C	Pathogenic	Missense variant, coding sequence variant
rs267606978	C>G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs267606979	A>G	Pathogenic	Missense variant, coding sequence variant
rs376173303	T>C	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant
rs397517278	G>T	Conflicting-interpretations-of-pathogenicity	5 prime UTR variant, upstream transcript variant, genic upstream transcript variant, intron variant
rs397517283	A>C,T	Likely-pathogenic	Missense variant, coding sequence variant
rs587776643	->TAA	Pathogenic	Coding sequence variant, inframe insertion
rs727504392	G>A	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs730880982	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs730882148	C>G	Pathogenic	Coding sequence variant, missense variant
rs1131692281	C>G,T	Pathogenic	Genic upstream transcript variant, 5 prime UTR variant, coding sequence variant, missense variant
rs1563161306	A>G	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(78)

miRTarBase ID	miRNA	Experiments
MIRT1262410	hsa-miR-132	CLIP-seq
MIRT1262411	hsa-miR-1324	CLIP-seq
MIRT1262412	hsa-miR-155	CLIP-seq
MIRT1262413	hsa-miR-205	CLIP-seq
MIRT1262414	hsa-miR-212	CLIP-seq
MIRT1262415	hsa-miR-3121-3p	CLIP-seq
MIRT1262416	hsa-miR-3140-5p	CLIP-seq
MIRT1262417	hsa-miR-3614-5p	CLIP-seq
MIRT1262418	hsa-miR-4258	CLIP-seq
MIRT1262419	hsa-miR-4293	CLIP-seq
MIRT1262420	hsa-miR-4766-5p	CLIP-seq
MIRT1262421	hsa-miR-500a	CLIP-seq
MIRT1262422	hsa-miR-548al	CLIP-seq
MIRT1262423	hsa-miR-570	CLIP-seq
MIRT1262424	hsa-miR-1183	CLIP-seq
MIRT1262425	hsa-miR-1305	CLIP-seq
MIRT1262426	hsa-miR-181a	CLIP-seq
MIRT1262427	hsa-miR-181b	CLIP-seq
MIRT1262428	hsa-miR-181c	CLIP-seq
MIRT1262429	hsa-miR-181d	CLIP-seq
MIRT1262430	hsa-miR-200b	CLIP-seq
MIRT1262431	hsa-miR-200c	CLIP-seq
MIRT1262432	hsa-miR-2053	CLIP-seq
MIRT1262433	hsa-miR-320a	CLIP-seq
MIRT1262434	hsa-miR-320b	CLIP-seq
MIRT1262435	hsa-miR-320c	CLIP-seq
MIRT1262436	hsa-miR-320d	CLIP-seq
MIRT1262437	hsa-miR-3613-5p	CLIP-seq
MIRT1262438	hsa-miR-3692	CLIP-seq
MIRT1262439	hsa-miR-423-3p	CLIP-seq
MIRT1262440	hsa-miR-425	CLIP-seq
MIRT1262441	hsa-miR-4262	CLIP-seq
MIRT1262442	hsa-miR-429	CLIP-seq
MIRT1262443	hsa-miR-4422	CLIP-seq
MIRT1262444	hsa-miR-4429	CLIP-seq
MIRT1262445	hsa-miR-4661-3p	CLIP-seq
MIRT1262446	hsa-miR-4775	CLIP-seq
MIRT1262447	hsa-miR-498	CLIP-seq
MIRT1262448	hsa-miR-548u	CLIP-seq
MIRT1262449	hsa-miR-590-3p	CLIP-seq
MIRT1262450	hsa-miR-617	CLIP-seq
MIRT1262451	hsa-miR-7	CLIP-seq
MIRT1262426	hsa-miR-181a	CLIP-seq
MIRT1262427	hsa-miR-181b	CLIP-seq
MIRT1262428	hsa-miR-181c	CLIP-seq
MIRT1262429	hsa-miR-181d	CLIP-seq
MIRT1262416	hsa-miR-3140-5p	CLIP-seq
MIRT2077365	hsa-miR-3163	CLIP-seq
MIRT1262441	hsa-miR-4262	CLIP-seq
MIRT2077366	hsa-miR-4668-3p	CLIP-seq
MIRT1262447	hsa-miR-498	CLIP-seq
MIRT2077367	hsa-miR-499-3p	CLIP-seq
MIRT2077368	hsa-miR-499a-3p	CLIP-seq
MIRT2303862	hsa-miR-1301	CLIP-seq
MIRT1262426	hsa-miR-181a	CLIP-seq
MIRT1262427	hsa-miR-181b	CLIP-seq
MIRT1262428	hsa-miR-181c	CLIP-seq
MIRT1262429	hsa-miR-181d	CLIP-seq
MIRT1262441	hsa-miR-4262	CLIP-seq
MIRT2303863	hsa-miR-4676-5p	CLIP-seq
MIRT2077367	hsa-miR-499-3p	CLIP-seq
MIRT2077368	hsa-miR-499a-3p	CLIP-seq
MIRT2303864	hsa-miR-5047	CLIP-seq
MIRT2303865	hsa-miR-575	CLIP-seq
MIRT2303866	hsa-miR-323-3p	CLIP-seq
MIRT2303867	hsa-miR-4496	CLIP-seq
MIRT2392977	hsa-miR-214	CLIP-seq
MIRT1262417	hsa-miR-3614-5p	CLIP-seq
MIRT2392978	hsa-miR-3619-5p	CLIP-seq
MIRT1262418	hsa-miR-4258	CLIP-seq
MIRT2392979	hsa-miR-4274	CLIP-seq
MIRT2392980	hsa-miR-4291	CLIP-seq
MIRT2392981	hsa-miR-4462	CLIP-seq
MIRT2392982	hsa-miR-4711-5p	CLIP-seq
MIRT2392983	hsa-miR-495	CLIP-seq
MIRT1262422	hsa-miR-548al	CLIP-seq
MIRT2392984	hsa-miR-761	CLIP-seq
MIRT2392985	hsa-miR-922	CLIP-seq

Show/Hide all(41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IDA	17255938
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005524	Function	ATP binding	IDA	15877279
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0005977	Process	Glycogen metabolic process	IMP	11827995, 15877279
GO:0006110	Process	Regulation of glycolytic process	IMP	15877279
GO:0006468	Process	Protein phosphorylation	IBA	21873635
GO:0006469	Process	Negative regulation of protein kinase activity	IDA	17255938
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006754	Process	ATP biosynthetic process	TAS	11371514
GO:0006853	Process	Carnitine shuttle	TAS
GO:0007050	Process	Cell cycle arrest	TAS
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	IMP	15877279
GO:0008607	Function	Phosphorylase kinase regulator activity	IMP	15877279
GO:0010800	Process	Positive regulation of peptidyl-threonine phosphorylation	IMP	15877279
GO:0016126	Process	Sterol biosynthetic process	TAS	9208914
GO:0016208	Function	AMP binding	IBA	21873635
GO:0016236	Process	Macroautophagy	TAS
GO:0016241	Process	Regulation of macroautophagy	TAS
GO:0019217	Process	Regulation of fatty acid metabolic process	IMP	15877279
GO:0019887	Function	Protein kinase regulator activity	IBA	21873635
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0019901	Function	Protein kinase binding	IDA	10698692
GO:0030295	Function	Protein kinase activator activity	IMP	15877279
GO:0031588	Component	Nucleotide-activated protein kinase complex	IBA	21873635
GO:0031588	Component	Nucleotide-activated protein kinase complex	IDA	15877279
GO:0032147	Process	Activation of protein kinase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IMP	15877279
GO:0042149	Process	Cellular response to glucose starvation	IBA	21873635
GO:0042304	Process	Regulation of fatty acid biosynthetic process	TAS
GO:0043531	Function	ADP binding	IDA	15877279
GO:0045860	Process	Positive regulation of protein kinase activity	IMP	15877279
GO:0046320	Process	Regulation of fatty acid oxidation	TAS	9208914
GO:0046324	Process	Regulation of glucose import	TAS	11827995
GO:0050790	Process	Regulation of catalytic activity	IBA	21873635
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:2000480	Process	Negative regulation of cAMP-dependent protein kinase activity	IEA

MIM	HGNC	e!Ensembl
602743	9386	ENSG00000106617

Protein

UniProt ID

Q9UGJ0

Protein name

5'-AMP-activated protein kinase subunit gamma-2 (AMPK gamma2) (AMPK subunit gamma-2) (H91620p)

Protein function

AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism (PubMed:14722619, PubMed:24563466). In response to reduction of intracellular ATP leve

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00571	CBS	355 → 410	CBS domain	Domain
PF00571	CBS	429 → 484	CBS domain	Domain
PF00571	CBS	502 → 556	CBS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform B is ubiquitously expressed except in liver and thymus. The highest level is detected in heart with abundant expression in placenta and testis.

Sequence

MGSAVMDTKKKKDVSSPGGSGGKKNASQKRRSLRVHIPDLSSFAMPLLDGDLEGSGKHSS
RKVDSPFGPGSPSKGFFSRGPQPRPSSPMSAPVRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPNSNPATSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEA
GMLEKLEFEDEAVEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANG
VRAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKP
LVNISPDASLFDAVYSLIKNKIHRLPVIDPISGNALYILTHKRILKFLQLFMSDMPKPAF
MKQNLDELGIGTYHNIAFIHPDTPIIKALNIFVERRISALPVVDESGKVVDIYSKFDVIN
LAAEKTYNNLDITVTQALQHRSQYFEGVVKCNKLEILETIVDRIVRAEVHRLVVVNEADS
IVGIISLSDILQALILTPAGAKQKETETE

Sequence length

569

Interactions

View interactions

Show/Hide Unknown Diseases (9)

Disease term	Disease name	Evidence	Source
Unknown
Hypertrophic cardiomyopathy	hypertrophic cardiomyopathy 6, hypertrophic cardiomyopathy		GenCC
Glycogen Storage Disease	lethal congenital glycogen storage disease of heart		GenCC
Kidney Disease	Kidney Disease		GWAS
Glaucoma	Glaucoma		GWAS
Gout	Gout		GWAS
Ovarian cancer	Ovarian cancer	Conditional KD of IL6 in the OCCA xenograft model delays tumor growth	GWAS, CBGDA
Hypertension	Hypertension		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA
Renal Carcinoma	Renal Carcinoma		GWAS

Show/Hide Text Mining Associations (68)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Associate	11827995, 15673802, 16716659
Activated Protein C Resistance	Associate	29298659
Adenomatous Polyposis Coli	Associate	23778007
Alzheimer Disease	Associate	32039845
Anorexia Nervosa	Associate	35703085
Arrhythmias Cardiac	Associate	11407343, 32646569
Atrial Fibrillation	Associate	32646569, 37203300
Atrioventricular Block	Associate	11827995
Autism Spectrum Disorder	Associate	31838722
Bornholm Eye Disease	Associate	33922358
Bradycardia	Associate	23741347, 35509080
Breast Neoplasms	Associate	23034890
Bulimia Nervosa	Associate	33922358
Cardiac Conduction System Disease	Associate	28690312
Cardiac form of generalized glycogenosis	Associate	15877279, 32646569
Cardiomegaly	Associate	11827995, 16716659, 23778007, 28546535, 28550180
Cardiomyopathies	Associate	28546535, 32150461, 32233023, 32646569, 35544052, 37932845
Cardiomyopathy Dilated	Associate	37932845
Cardiomyopathy Hypertrophic	Associate	15673802, 15766830, 15877279, 16716659, 23741347, 28498465, 28550180, 28771489, 28797094, 29298659, 30775854, 31347270, 32150461, 35413566, 37466024
Cardiomyopathy Hypertrophic Familial	Associate	16716659, 18403758, 28498465, 28690312
Cardiovascular Diseases	Associate	30813608
Chest Pain	Associate	15766830
Chromosome Aberrations	Associate	31345272
Colorectal Neoplasms	Associate	20622004
Conduct Disorder	Associate	23741347, 23778007
Death Sudden	Associate	31347270
Death Sudden Cardiac	Associate	15877279, 28546535, 28690312, 35509080, 36221081
Diabetes Mellitus	Associate	20682687, 28690312
Diabetic Nephropathies	Associate	29703844
Disease	Associate	15766830, 32646569
Epileptic Syndromes	Associate	16716659
Fibrosis	Associate	11827995, 28690312
Genetic Diseases Inborn	Associate	11407343
Gerstmann Straussler Scheinker Disease	Associate	33782433
Glycogen Storage Disease Type II	Associate	27692944
Glycogen Storage Disease Type IIb	Associate	15673802
Heart Arrest	Associate	28690312
Heart Defects Congenital	Associate	15877279
Heart Diseases	Associate	11827995, 15766830, 27692944, 28550180, 31347270, 37932845
Heart Failure	Associate	23741347, 32646569, 37932845
Hemorrhage	Associate	37203300
Hypertrophy	Associate	11827995, 23741347, 26496977, 28550180, 29298659
Hypertrophy Left Ventricular	Associate	15673802, 15766830, 23741347, 35509080
Hypertrophy Right Ventricular	Associate	16716659
Hypoxia	Associate	37932845
Inclusion Body Myopathy 3 Autosomal Dominant	Associate	15766830
Ischemic Attack Transient	Associate	28690312
Isolated Noncompaction of the Ventricular Myocardium	Associate	36221081
Learning Disabilities	Associate	28690312
Long QT Syndrome	Associate	34582124
Metabolic Diseases	Associate	11827995
Microvascular Angina	Associate	23741347, 23778007, 28690312, 29298659
Myalgia	Associate	15766830
Myocardial Ischemia	Associate	37932845
Non ST Elevated Myocardial Infarction	Associate	29298659
Obesity	Associate	29107296, 33922358, 39174891
Pancreatic Neoplasms	Stimulate	30997723
Pancreatic Neoplasms	Associate	30997723
Pre Excitation Syndromes	Associate	11407343, 11827995, 15673802, 16716659, 23741347, 23778007, 28546535, 28550180
Prostatic Neoplasms Castration Resistant	Associate	32704143
Pulmonary Disease Chronic Obstructive	Associate	30248490
Rectal Neoplasms	Associate	20622004
Renal Insufficiency Chronic	Associate	20383146, 21980298, 24253112, 35446786
Syncope	Associate	15766830
Syndrome	Associate	35509080
Ventricular Dysfunction Left	Associate	26496977
Ventricular Outflow Obstruction Left	Associate	16716659
Wolff Parkinson White Syndrome	Associate	11407343, 11827995, 15766830, 15877279, 28690312, 29298659

PRKAG2 (protein kinase AMP-activated non-catalytic subunit gamma 2)