Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5571
Gene name Gene Name - the full gene name approved by the HGNC.
Protein kinase AMP-activated non-catalytic subunit gamma 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRKAG1
Synonyms (NCBI Gene) Gene synonyms aliases
AMPKG
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022607 hsa-miR-124-3p Microarray 18668037
MIRT023779 hsa-miR-1-3p Proteomics 18668040
MIRT045971 hsa-miR-125b-5p CLASH 23622248
MIRT037198 hsa-miR-877-3p CLASH 23622248
MIRT637068 hsa-miR-6768-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004679 Function AMP-activated protein kinase activity IEA
GO:0004691 Function CAMP-dependent protein kinase activity TAS
GO:0005515 Function Protein binding IPI 16306228, 17028174, 18403135, 18480843, 20562859, 21988832, 22363791, 23455922, 24722188, 25416956, 25852190, 28514442, 28561066, 31515488, 32296183, 32707033, 32814053, 33961781, 35271311
GO:0005524 Function ATP binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602742 9385 ENSG00000181929
Protein
UniProt ID P54619
Protein name 5'-AMP-activated protein kinase subunit gamma-1 (AMPK gamma1) (AMPK subunit gamma-1) (AMPKg)
Protein function AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism (PubMed:21680840, PubMed:24563466). In response to reduction of intracellular ATP leve
PDB 2UV4 , 2UV5 , 2UV6 , 2UV7 , 4CFE , 4CFF , 4RER , 4REW , 4ZHX , 5EZV , 5ISO , 6B1U , 6B2E , 6C9F , 6C9G , 6C9H , 6C9J , 7JHG , 7JHH , 7JIJ , 7M74 , 7MYJ , 8BIK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00571 CBS 120 178 CBS domain Domain
PF00571 CBS 185 252 CBS domain Domain
PF00571 CBS 269 324 CBS domain Domain
Sequence
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKL
FI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAE
KTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVL
TGGEKKP
Sequence length 331
Interactions View interactions
<