Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5568
Gene name Gene Name - the full gene name approved by the HGNC.	Protein kinase cAMP-activated catalytic subunit gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PRKACG
Synonyms (NCBI Gene) Gene synonyms aliases	BDPLT19, KAPG, PKACg
Disease Acronyms (UniProt) Disease acronyms from UniProt database	BDPLT19
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q21.11
Summary Summary of gene provided in NCBI Entrez Gene.	Cyclic AMP-dependent protein kinase (PKA) consists of two catalytic subunits and a regulatory subunit dimer. This gene encodes the gamma form of its catalytic subunit. The gene is intronless and is thought to be a retrotransposon derived from the gene for

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs724159972	G>C	Pathogenic	Missense variant, coding sequence variant

Show/Hide all(37)

miRTarBase ID	miRNA	Experiments
MIRT1262351	hsa-miR-1207-3p	CLIP-seq
MIRT1262352	hsa-miR-138	CLIP-seq
MIRT1262353	hsa-miR-1915	CLIP-seq
MIRT1262354	hsa-miR-298	CLIP-seq
MIRT1262355	hsa-miR-3126-5p	CLIP-seq
MIRT1262356	hsa-miR-3154	CLIP-seq
MIRT1262357	hsa-miR-3159	CLIP-seq
MIRT1262358	hsa-miR-3160-3p	CLIP-seq
MIRT1262359	hsa-miR-3179	CLIP-seq
MIRT1262360	hsa-miR-3667-3p	CLIP-seq
MIRT1262361	hsa-miR-4251	CLIP-seq
MIRT1262362	hsa-miR-4419a	CLIP-seq
MIRT1262363	hsa-miR-4492	CLIP-seq
MIRT1262364	hsa-miR-4498	CLIP-seq
MIRT1262365	hsa-miR-4510	CLIP-seq
MIRT1262366	hsa-miR-4514	CLIP-seq
MIRT1262367	hsa-miR-4645-5p	CLIP-seq
MIRT1262368	hsa-miR-4673	CLIP-seq
MIRT1262369	hsa-miR-4692	CLIP-seq
MIRT1262370	hsa-miR-4694-5p	CLIP-seq
MIRT1262371	hsa-miR-4710	CLIP-seq
MIRT1262372	hsa-miR-4726-3p	CLIP-seq
MIRT1262373	hsa-miR-539	CLIP-seq
MIRT1262374	hsa-miR-646	CLIP-seq
MIRT1262375	hsa-miR-762	CLIP-seq
MIRT1262376	hsa-miR-940	CLIP-seq
MIRT1262353	hsa-miR-1915	CLIP-seq
MIRT2077353	hsa-miR-3183	CLIP-seq
MIRT1262360	hsa-miR-3667-3p	CLIP-seq
MIRT1262366	hsa-miR-4514	CLIP-seq
MIRT1262367	hsa-miR-4645-5p	CLIP-seq
MIRT1262368	hsa-miR-4673	CLIP-seq
MIRT1262369	hsa-miR-4692	CLIP-seq
MIRT2077354	hsa-miR-4723-3p	CLIP-seq
MIRT1262372	hsa-miR-4726-3p	CLIP-seq
MIRT1262376	hsa-miR-940	CLIP-seq
MIRT1262355	hsa-miR-3126-5p	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002223	Process	Stimulatory C-type lectin receptor signaling pathway	TAS
GO:0003091	Process	Renal water homeostasis	TAS
GO:0004679	Function	AMP-activated protein kinase activity	IEA
GO:0004691	Function	CAMP-dependent protein kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IEA
GO:0007283	Process	Spermatogenesis	TAS	9598317
GO:0007596	Process	Blood coagulation	TAS
GO:0008584	Process	Male gonad development	TAS	9598317
GO:0010737	Process	Protein kinase A signaling	IBA	21873635
GO:0034199	Process	Activation of protein kinase A activity	TAS
GO:0034237	Function	Protein kinase A regulatory subunit binding	IBA	21873635
GO:0034380	Process	High-density lipoprotein particle assembly	TAS
GO:0071377	Process	Cellular response to glucagon stimulus	TAS
GO:0097546	Component	Ciliary base	TAS

MIM	HGNC	e!Ensembl
176893	9382	ENSG00000165059

Protein

UniProt ID

P22612

Protein name

cAMP-dependent protein kinase catalytic subunit gamma (PKA C-gamma) (EC 2.7.11.11)

Protein function

Phosphorylates a large number of substrates in the cytoplasm and the nucleus.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	44 → 298	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Testis specific. But important tissues such as brain and ovary have not been analyzed for the content of transcript.

Sequence

MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF

Sequence length

351

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Platelet-type bleeding disorder	platelet-type bleeding disorder 19			GenCC

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Blood Platelet Disorders	Associate	25061177
Breast Neoplasms	Associate	33991172
Gonadal Dysgenesis 46 XY	Associate	24055526
Hemorrhage	Associate	25323684
Leukemia Myeloid Acute	Associate	30289875
Macrothrombocytopenia Autosomal Dominant Tubb1 Related	Associate	25061177
Melanoma	Associate	24185007
Neoplasms	Associate	35505292
Purpura Thrombocytopenic Idiopathic	Associate	33222560
Thrombasthenia Thrombocytopenia Hereditary	Associate	25061177
Tomaculous neuropathy	Associate	25061177

PRKACG (protein kinase cAMP-activated catalytic subunit gamma)