Gene Gene information from NCBI Gene database.
Entrez ID 5565
Gene name Protein kinase AMP-activated non-catalytic subunit beta 2
Gene symbol PRKAB2
Synonyms (NCBI Gene)
-
Chromosome 1
Chromosome location 1q21.1
Summary The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
miRNA miRNA information provided by mirtarbase database.
948
miRTarBase ID miRNA Experiments Reference
MIRT020411 hsa-miR-29c-3p Sequencing 20371350
MIRT027116 hsa-miR-103a-3p Sequencing 20371350
MIRT030833 hsa-miR-21-5p Microarray 18591254
MIRT031580 hsa-miR-16-5p Sequencing 20371350
MIRT047852 hsa-miR-30c-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
22
GO ID Ontology Definition Evidence Reference
GO:0004679 Function AMP-activated protein kinase activity IDA 21399626
GO:0005515 Function Protein binding IPI 16306228, 20562859, 21516116, 21988832, 22363791, 23455922, 24722188, 25416956, 25852190, 27107012, 28514442, 29892012, 31515488, 32296183, 32707033, 32814053, 33961781, 35271311, 35512704
GO:0005634 Component Nucleus IBA
GO:0005654 Component Nucleoplasm TAS
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602741 9379 ENSG00000131791
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43741
Protein name 5'-AMP-activated protein kinase subunit beta-2 (AMPK subunit beta-2)
Protein function Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing p
PDB 2F15 , 2V8Q , 2V92 , 2V9J , 2Y8L , 2Y8Q , 2YA3 , 4CFH , 4EAI , 4EAJ , 4RER , 4REW , 6B2E , 7JHG , 7JHH , 7JIJ , 7M74
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16561 AMPK1_CBM 77 161 Glycogen recognition site of AMP-activated protein kinase Family
PF04739 AMPKBI 201 271 Family
Sequence
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFE
VFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKP
I
Sequence length 272
Interactions View interactions