Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5565
Gene name Gene Name - the full gene name approved by the HGNC.
Protein kinase AMP-activated non-catalytic subunit beta 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRKAB2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020411 hsa-miR-29c-3p Sequencing 20371350
MIRT027116 hsa-miR-103a-3p Sequencing 20371350
MIRT030833 hsa-miR-21-5p Microarray 18591254
MIRT031580 hsa-miR-16-5p Sequencing 20371350
MIRT047852 hsa-miR-30c-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004679 Function AMP-activated protein kinase activity IDA 21399626
GO:0005515 Function Protein binding IPI 16306228, 20562859, 21516116, 21988832, 22363791, 23455922, 24722188, 25416956, 25852190, 27107012, 28514442, 29892012, 31515488, 32296183, 32707033, 32814053, 33961781, 35271311, 35512704
GO:0005634 Component Nucleus IBA
GO:0005654 Component Nucleoplasm TAS
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602741 9379 ENSG00000131791
Protein
UniProt ID O43741
Protein name 5'-AMP-activated protein kinase subunit beta-2 (AMPK subunit beta-2)
Protein function Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing p
PDB 2F15 , 2V8Q , 2V92 , 2V9J , 2Y8L , 2Y8Q , 2YA3 , 4CFH , 4EAI , 4EAJ , 4RER , 4REW , 6B2E , 7JHG , 7JHH , 7JIJ , 7M74
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16561 AMPK1_CBM 77 161 Glycogen recognition site of AMP-activated protein kinase Family
PF04739 AMPKBI 201 271 Family
Sequence
MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFV
SWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFE
VFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKP
I
Sequence length 272
Interactions View interactions
<