Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5564
Gene name Gene Name - the full gene name approved by the HGNC.
Protein kinase AMP-activated non-catalytic subunit beta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRKAB1
Synonyms (NCBI Gene) Gene synonyms aliases
AMPK, HAMPKb
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.23
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004527 hsa-miR-122-5p Luciferase reporter assay 16459310
MIRT053237 hsa-miR-148b-3p Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot 23171948
MIRT719926 hsa-miR-483-3p HITS-CLIP 19536157
MIRT719927 hsa-miR-4733-3p HITS-CLIP 19536157
MIRT719926 hsa-miR-483-3p HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
TP53 Unknown 12771025
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16306228, 17028174, 18403135, 18480843, 18624398, 20562859, 21072212, 21988832, 22363791, 23455922, 25686248, 25852190, 28514442, 28561066, 32296183, 32707033, 33961781, 35271311
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 9693118
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602740 9378 ENSG00000111725
Protein
UniProt ID Q9Y478
Protein name 5'-AMP-activated protein kinase subunit beta-1 (AMPK subunit beta-1) (AMPKb)
Protein function Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing p
PDB 4CFE , 4CFF , 4ZHX , 5EZV , 5ISO , 6B1U , 6C9F , 6C9G , 6C9H , 6C9J , 7MYJ , 8BIK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16561 AMPK1_CBM 78 161 Glycogen recognition site of AMP-activated protein kinase Family
PF04739 AMPKBI 199 269 Family
Sequence
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFE
VFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKP
I
Sequence length 270
Interactions View interactions
<