Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5522
Gene name Gene Name - the full gene name approved by the HGNC.
Protein phosphatase 2 regulatory subunit Bgamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PPP2R2C
Synonyms (NCBI Gene) Gene synonyms aliases
B55-GAMMA, B55gamma, IMYPNO, IMYPNO1, PR52, PR55G
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.1
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT021554 hsa-miR-142-3p Microarray 17612493
MIRT1257566 hsa-miR-1284 CLIP-seq
MIRT1257567 hsa-miR-300 CLIP-seq
MIRT1257568 hsa-miR-3591-3p CLIP-seq
MIRT1257569 hsa-miR-3613-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000159 Component Protein phosphatase type 2A complex IBA
GO:0000159 Component Protein phosphatase type 2A complex IEA
GO:0000159 Component Protein phosphatase type 2A complex NAS 10945473
GO:0005515 Function Protein binding IPI 19156129, 24126060, 25816751, 33961781
GO:0005829 Component Cytosol IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605997 9306 ENSG00000074211
Protein
UniProt ID Q9Y2T4
Protein name Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform (IMYPNO1) (PP2A subunit B isoform B55-gamma) (PP2A subunit B isoform PR55-gamma) (PP2A subunit B isoform R2-gamma) (PP2A subunit B isoform gamma)
Protein function The B regulatory subunit might modulate substrate selectivity and catalytic activity, and might also direct the localization of the catalytic enzyme to a particular subcellular compartment.
Family and domains
Sequence
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRIFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH
Sequence length 447
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anorexia Nervosa Associate 35013117
Autism Spectrum Disorder Associate 31541176
Bipolar Disorder Associate 24387768
Diabetes Mellitus Type 2 Associate 35013117
Hemochromatosis Associate 31730496
Neoplasms Associate 23493267, 32689909
Neoplasms Inhibit 35977016
Osteosarcoma Associate 37272097
Ovarian Neoplasms Associate 32878513
Prostatic Neoplasms Inhibit 23493267