Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5520
Gene name Gene Name - the full gene name approved by the HGNC.
Protein phosphatase 2 regulatory subunit Balpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PPP2R2A
Synonyms (NCBI Gene) Gene synonyms aliases
B55, B55A, B55ALPHA, PR52A, PR55A, PR55alpha
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heter
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000490 hsa-miR-31-5p qRT-PCR, Luciferase reporter assay 20237410
MIRT003191 hsa-miR-222-3p Luciferase reporter assay, Western blot 20103675
MIRT003191 hsa-miR-222-3p Luciferase reporter assay, Western blot 20103675
MIRT020735 hsa-miR-155-5p Proteomics 18668040
MIRT023787 hsa-miR-1-3p Proteomics 18668040
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle TAS
GO:0000159 Component Protein phosphatase type 2A complex IBA 21873635
GO:0000159 Component Protein phosphatase type 2A complex IDA 1849734, 17245430
GO:0000184 Process Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay TAS
GO:0005515 Function Protein binding IPI 9847399, 15761952, 17245430, 17529992, 17540176, 17632056, 18782753, 19156129, 19293187, 19915589, 20711181, 25816751, 26496610, 26894577, 27173435, 27588481, 28330616, 28609714, 30595372, 30611118, 31046837, 32814053, 33108758
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604941 9304 ENSG00000221914
Protein
UniProt ID P63151
Protein name Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform (PP2A subunit B isoform B55-alpha) (B55) (PP2A subunit B isoform PR55-alpha) (PP2A subunit B isoform R2-alpha) (PP2A subunit B isoform alpha)
Protein function Substrate-recognition subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit (PubMed:1849734, PubMed:33108758). Involved in chromosome clustering during late mitosis by mediating dephos
PDB 3DW8 , 8SO0 , 8TTB , 8TWE
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined. {ECO:0000269|PubMed:1849734}.
Sequence
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
Sequence length 447
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Coronary artery disease Coronary artery disease GWAS
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Hypertension Hypertension GWAS
Associations from Text Mining
Disease Name Relationship Type References
Ataxia Telangiectasia Associate 19430199
Breast Neoplasms Associate 19890961, 22522925, 25879784, 36781846
Carcinoma Hepatocellular Associate 35945177, 36378050
Carcinoma Non Small Cell Lung Associate 23959478, 32950569
Esophageal Squamous Cell Carcinoma Associate 36803971
Leukemia Associate 24858343, 27531894
Leukemia Myeloid Acute Associate 21660042, 24858343, 27531894
Lipoblastoma Associate 33097826
Lymphoma Large B Cell Diffuse Associate 27720936
Melanoma Associate 32767816