Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10891
Gene name Gene Name - the full gene name approved by the HGNC.	PPARG coactivator 1 alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PPARGC1A
Synonyms (NCBI Gene) Gene synonyms aliases	LEM6, PGC-1(alpha), PGC-1alpha, PGC-1v, PGC1, PGC1A, PPARGC1
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4p15.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protei

Show/Hide all(489)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT006280	hsa-miR-23a-3p	Luciferase reporter assay	22318941
MIRT017345	hsa-miR-335-5p	Microarray	18185580
MIRT027602	hsa-miR-98-5p	Microarray	19088304
MIRT051970	hsa-let-7b-5p	CLASH	23622248
MIRT043961	hsa-miR-378a-5p	CLASH	23622248
MIRT042423	hsa-miR-425-3p	CLASH	23622248
MIRT039358	hsa-miR-421	CLASH	23622248
MIRT438552	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23868745
MIRT438552	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23868745
MIRT438552	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23868745
MIRT438552	hsa-miR-130b-3p	Luciferase reporter assay, qRT-PCR, Western blot	23868745
MIRT725214	hsa-miR-8485	HITS-CLIP	19536157
MIRT725213	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT725212	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT725211	hsa-miR-603	HITS-CLIP	19536157
MIRT725210	hsa-miR-4789-3p	HITS-CLIP	19536157
MIRT725209	hsa-miR-8064	HITS-CLIP	19536157
MIRT725208	hsa-miR-3941	HITS-CLIP	19536157
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521784	hsa-miR-6083	HITS-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521789	hsa-miR-32-3p	HITS-CLIP	22927820
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	22927820
MIRT521786	hsa-miR-4775	HITS-CLIP	22927820
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	22927820
MIRT521784	hsa-miR-6083	HITS-CLIP	22927820
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	22927820
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT521784	hsa-miR-6083	HITS-CLIP	23313552
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521784	hsa-miR-6083	PAR-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT521789	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT521787	hsa-miR-3124-3p	PAR-CLIP	23446348
MIRT521786	hsa-miR-4775	PAR-CLIP	23446348
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT521784	hsa-miR-6083	PAR-CLIP	23446348
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT731334	hsa-miR-485-3p	Luciferase reporter assay	27010860
MIRT731334	hsa-miR-485-3p	Luciferase reporter assay	27010860
MIRT731335	hsa-miR-485-5p	Luciferase reporter assay	27010860
MIRT731335	hsa-miR-485-5p	Luciferase reporter assay	27010860
MIRT735309	hsa-miR-3619-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32300102
MIRT737820	hsa-miR-211	HITS-CLIP	33718276
MIRT737822	hsa-miR-623	HITS-CLIP	33718276
MIRT725214	hsa-miR-8485	HITS-CLIP	19536157
MIRT725213	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT725212	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT725211	hsa-miR-603	HITS-CLIP	19536157
MIRT725210	hsa-miR-4789-3p	HITS-CLIP	19536157
MIRT725209	hsa-miR-8064	HITS-CLIP	19536157
MIRT725208	hsa-miR-3941	HITS-CLIP	19536157
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT521784	hsa-miR-6083	HITS-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT521789	hsa-miR-32-3p	HITS-CLIP	22927820
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	22927820
MIRT521786	hsa-miR-4775	HITS-CLIP	22927820
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	22927820
MIRT521784	hsa-miR-6083	HITS-CLIP	22927820
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	22927820
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT521784	hsa-miR-6083	HITS-CLIP	23313552
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT521785	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT622631	hsa-miR-5585-3p	HITS-CLIP	23824327
MIRT521783	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521784	hsa-miR-6083	PAR-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT521789	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT521788	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT521787	hsa-miR-3124-3p	PAR-CLIP	23446348
MIRT521786	hsa-miR-4775	PAR-CLIP	23446348
MIRT521785	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT521784	hsa-miR-6083	PAR-CLIP	23446348
MIRT521783	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT755680	hsa-miR-193b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36835287
MIRT1251822	hsa-miR-1273g	CLIP-seq
MIRT1251823	hsa-miR-130a	CLIP-seq
MIRT1251824	hsa-miR-130b	CLIP-seq
MIRT737819	hsa-miR-204	CLIP-seq
MIRT1251825	hsa-miR-2052	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT1251826	hsa-miR-2277-3p	CLIP-seq
MIRT1251827	hsa-miR-23a	CLIP-seq
MIRT1251828	hsa-miR-23b	CLIP-seq
MIRT1251829	hsa-miR-23c	CLIP-seq
MIRT1251830	hsa-miR-301a	CLIP-seq
MIRT1251831	hsa-miR-301b	CLIP-seq
MIRT1251832	hsa-miR-3074-3p	CLIP-seq
MIRT1251833	hsa-miR-30a	CLIP-seq
MIRT1251834	hsa-miR-30b	CLIP-seq
MIRT1251835	hsa-miR-30c	CLIP-seq
MIRT1251836	hsa-miR-30d	CLIP-seq
MIRT1251837	hsa-miR-30e	CLIP-seq
MIRT1251838	hsa-miR-3163	CLIP-seq
MIRT1251839	hsa-miR-323b-5p	CLIP-seq
MIRT1251840	hsa-miR-3647-3p	CLIP-seq
MIRT1251841	hsa-miR-3666	CLIP-seq
MIRT1251842	hsa-miR-409-3p	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT1251843	hsa-miR-4295	CLIP-seq
MIRT737823	hsa-miR-4446-5p	CLIP-seq
MIRT1251844	hsa-miR-4461	CLIP-seq
MIRT1251845	hsa-miR-454	CLIP-seq
MIRT1251846	hsa-miR-4668-3p	CLIP-seq
MIRT1251847	hsa-miR-4671-3p	CLIP-seq
MIRT737821	hsa-miR-4755-5p	CLIP-seq
MIRT1251848	hsa-miR-4797-5p	CLIP-seq
MIRT1251849	hsa-miR-487a	CLIP-seq
MIRT737825	hsa-miR-494	CLIP-seq
MIRT737824	hsa-miR-543	CLIP-seq
MIRT1251850	hsa-miR-660	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT1552511	hsa-miR-193a-3p	CLIP-seq
MIRT1552512	hsa-miR-193b	CLIP-seq
MIRT1552513	hsa-miR-200b	CLIP-seq
MIRT1552514	hsa-miR-200c	CLIP-seq
MIRT1552515	hsa-miR-429	CLIP-seq
MIRT1552516	hsa-miR-4662a-3p	CLIP-seq
MIRT1552517	hsa-miR-892b	CLIP-seq
MIRT737813	hsa-miR-1206	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT737812	hsa-miR-4495	CLIP-seq
MIRT737814	hsa-miR-646	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT2074246	hsa-miR-1197	CLIP-seq
MIRT2074247	hsa-miR-1283	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT2074248	hsa-miR-221	CLIP-seq
MIRT2074249	hsa-miR-222	CLIP-seq
MIRT2074250	hsa-miR-3607-3p	CLIP-seq
MIRT2074251	hsa-miR-3686	CLIP-seq
MIRT2074252	hsa-miR-371b-5p	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT2074253	hsa-miR-4325	CLIP-seq
MIRT2074254	hsa-miR-4698	CLIP-seq
MIRT2074255	hsa-miR-4753-3p	CLIP-seq
MIRT2074256	hsa-miR-4778-5p	CLIP-seq
MIRT2074257	hsa-miR-548c-3p	CLIP-seq
MIRT2074258	hsa-miR-548v	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT2074259	hsa-miR-888	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT2074260	hsa-miR-944	CLIP-seq
MIRT2301255	hsa-miR-1243	CLIP-seq
MIRT2074247	hsa-miR-1283	CLIP-seq
MIRT2301256	hsa-miR-1324	CLIP-seq
MIRT1552511	hsa-miR-193a-3p	CLIP-seq
MIRT1552512	hsa-miR-193b	CLIP-seq
MIRT1552513	hsa-miR-200b	CLIP-seq
MIRT1552514	hsa-miR-200c	CLIP-seq
MIRT2301257	hsa-miR-3153	CLIP-seq
MIRT2301258	hsa-miR-329	CLIP-seq
MIRT2301259	hsa-miR-338-5p	CLIP-seq
MIRT1251840	hsa-miR-3647-3p	CLIP-seq
MIRT2301260	hsa-miR-3654	CLIP-seq
MIRT2301261	hsa-miR-3664-5p	CLIP-seq
MIRT1552515	hsa-miR-429	CLIP-seq
MIRT2301262	hsa-miR-4480	CLIP-seq
MIRT2301263	hsa-miR-4509	CLIP-seq
MIRT1552516	hsa-miR-4662a-3p	CLIP-seq
MIRT2301264	hsa-miR-4714-5p	CLIP-seq
MIRT2301265	hsa-miR-4727-5p	CLIP-seq
MIRT2301266	hsa-miR-4744	CLIP-seq
MIRT2301267	hsa-miR-4769-3p	CLIP-seq
MIRT2301268	hsa-miR-5096	CLIP-seq
MIRT2301269	hsa-miR-642a	CLIP-seq
MIRT2301270	hsa-miR-671-5p	CLIP-seq
MIRT1552517	hsa-miR-892b	CLIP-seq
MIRT2074254	hsa-miR-4698	CLIP-seq
MIRT2439579	hsa-miR-511	CLIP-seq
MIRT2074246	hsa-miR-1197	CLIP-seq
MIRT737813	hsa-miR-1206	CLIP-seq
MIRT2301255	hsa-miR-1243	CLIP-seq
MIRT2074247	hsa-miR-1283	CLIP-seq
MIRT1251823	hsa-miR-130a	CLIP-seq
MIRT1251824	hsa-miR-130b	CLIP-seq
MIRT2597904	hsa-miR-139-5p	CLIP-seq
MIRT2597905	hsa-miR-151-3p	CLIP-seq
MIRT2597906	hsa-miR-196a	CLIP-seq
MIRT2597907	hsa-miR-196b	CLIP-seq
MIRT2597908	hsa-miR-19a	CLIP-seq
MIRT2597909	hsa-miR-19b	CLIP-seq
MIRT2597910	hsa-miR-2116	CLIP-seq
MIRT2597911	hsa-miR-2117	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT2597912	hsa-miR-218	CLIP-seq
MIRT2074248	hsa-miR-221	CLIP-seq
MIRT2074249	hsa-miR-222	CLIP-seq
MIRT1251826	hsa-miR-2277-3p	CLIP-seq
MIRT1251827	hsa-miR-23a	CLIP-seq
MIRT1251828	hsa-miR-23b	CLIP-seq
MIRT1251829	hsa-miR-23c	CLIP-seq
MIRT1251830	hsa-miR-301a	CLIP-seq
MIRT1251831	hsa-miR-301b	CLIP-seq
MIRT1251833	hsa-miR-30a	CLIP-seq
MIRT1251834	hsa-miR-30b	CLIP-seq
MIRT1251835	hsa-miR-30c	CLIP-seq
MIRT1251836	hsa-miR-30d	CLIP-seq
MIRT1251837	hsa-miR-30e	CLIP-seq
MIRT2597913	hsa-miR-3119	CLIP-seq
MIRT2597914	hsa-miR-3120-5p	CLIP-seq
MIRT2597915	hsa-miR-3145-5p	CLIP-seq
MIRT2597916	hsa-miR-3152-5p	CLIP-seq
MIRT2597917	hsa-miR-3177-5p	CLIP-seq
MIRT2597918	hsa-miR-3183	CLIP-seq
MIRT2597919	hsa-miR-3201	CLIP-seq
MIRT2597920	hsa-miR-324-5p	CLIP-seq
MIRT2301259	hsa-miR-338-5p	CLIP-seq
MIRT2597921	hsa-miR-3591-5p	CLIP-seq
MIRT2597922	hsa-miR-3613-3p	CLIP-seq
MIRT2597923	hsa-miR-3613-5p	CLIP-seq
MIRT2597924	hsa-miR-3616-5p	CLIP-seq
MIRT1251840	hsa-miR-3647-3p	CLIP-seq
MIRT2597925	hsa-miR-3647-5p	CLIP-seq
MIRT2301260	hsa-miR-3654	CLIP-seq
MIRT1251841	hsa-miR-3666	CLIP-seq
MIRT2597926	hsa-miR-3671	CLIP-seq
MIRT2597927	hsa-miR-3692	CLIP-seq
MIRT2597928	hsa-miR-3917	CLIP-seq
MIRT2597929	hsa-miR-3927	CLIP-seq
MIRT1251842	hsa-miR-409-3p	CLIP-seq
MIRT2597930	hsa-miR-410	CLIP-seq
MIRT2597931	hsa-miR-4273	CLIP-seq
MIRT2597932	hsa-miR-4280	CLIP-seq
MIRT2597933	hsa-miR-4282	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT1251843	hsa-miR-4295	CLIP-seq
MIRT2074253	hsa-miR-4325	CLIP-seq
MIRT2597934	hsa-miR-4436b-5p	CLIP-seq
MIRT737812	hsa-miR-4495	CLIP-seq
MIRT2597935	hsa-miR-4528	CLIP-seq
MIRT1251845	hsa-miR-454	CLIP-seq
MIRT2597936	hsa-miR-4650-3p	CLIP-seq
MIRT2597937	hsa-miR-4670-3p	CLIP-seq
MIRT1251847	hsa-miR-4671-3p	CLIP-seq
MIRT2597938	hsa-miR-4677-5p	CLIP-seq
MIRT2597939	hsa-miR-4684-3p	CLIP-seq
MIRT2597940	hsa-miR-4690-3p	CLIP-seq
MIRT2597941	hsa-miR-4723-3p	CLIP-seq
MIRT2074255	hsa-miR-4753-3p	CLIP-seq
MIRT2597942	hsa-miR-4762-5p	CLIP-seq
MIRT2597943	hsa-miR-4766-3p	CLIP-seq
MIRT2597944	hsa-miR-4772-5p	CLIP-seq
MIRT2074256	hsa-miR-4778-5p	CLIP-seq
MIRT2597945	hsa-miR-4791	CLIP-seq
MIRT2597946	hsa-miR-4795-3p	CLIP-seq
MIRT2597947	hsa-miR-4799-5p	CLIP-seq
MIRT2597948	hsa-miR-4802-3p	CLIP-seq
MIRT1251849	hsa-miR-487a	CLIP-seq
MIRT2301268	hsa-miR-5096	CLIP-seq
MIRT2439579	hsa-miR-511	CLIP-seq
MIRT2597949	hsa-miR-513a-3p	CLIP-seq
MIRT2597950	hsa-miR-518a-5p	CLIP-seq
MIRT2597951	hsa-miR-527	CLIP-seq
MIRT2597952	hsa-miR-548a-5p	CLIP-seq
MIRT2597953	hsa-miR-548ab	CLIP-seq
MIRT2597954	hsa-miR-548ak	CLIP-seq
MIRT2597955	hsa-miR-548b-5p	CLIP-seq
MIRT2597956	hsa-miR-548c-5p	CLIP-seq
MIRT2597957	hsa-miR-548d-5p	CLIP-seq
MIRT2597958	hsa-miR-548h	CLIP-seq
MIRT2597959	hsa-miR-548i	CLIP-seq
MIRT2597960	hsa-miR-548j	CLIP-seq
MIRT2597961	hsa-miR-548k	CLIP-seq
MIRT2597962	hsa-miR-548l	CLIP-seq
MIRT2597963	hsa-miR-548p	CLIP-seq
MIRT2074258	hsa-miR-548v	CLIP-seq
MIRT2597964	hsa-miR-548w	CLIP-seq
MIRT2597965	hsa-miR-548y	CLIP-seq
MIRT2597966	hsa-miR-559	CLIP-seq
MIRT2597967	hsa-miR-562	CLIP-seq
MIRT2597968	hsa-miR-573	CLIP-seq
MIRT2597969	hsa-miR-578	CLIP-seq
MIRT2597970	hsa-miR-593	CLIP-seq
MIRT2597971	hsa-miR-636	CLIP-seq
MIRT2301269	hsa-miR-642a	CLIP-seq
MIRT2597972	hsa-miR-642b	CLIP-seq
MIRT737814	hsa-miR-646	CLIP-seq
MIRT2597973	hsa-miR-654-3p	CLIP-seq
MIRT2597974	hsa-miR-7	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT1552517	hsa-miR-892b	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT2074260	hsa-miR-944	CLIP-seq
MIRT2074246	hsa-miR-1197	CLIP-seq
MIRT737813	hsa-miR-1206	CLIP-seq
MIRT2301255	hsa-miR-1243	CLIP-seq
MIRT2074247	hsa-miR-1283	CLIP-seq
MIRT1251823	hsa-miR-130a	CLIP-seq
MIRT1251824	hsa-miR-130b	CLIP-seq
MIRT2597904	hsa-miR-139-5p	CLIP-seq
MIRT2597905	hsa-miR-151-3p	CLIP-seq
MIRT2597906	hsa-miR-196a	CLIP-seq
MIRT2597907	hsa-miR-196b	CLIP-seq
MIRT2597908	hsa-miR-19a	CLIP-seq
MIRT2597909	hsa-miR-19b	CLIP-seq
MIRT1251825	hsa-miR-2052	CLIP-seq
MIRT2597910	hsa-miR-2116	CLIP-seq
MIRT2597911	hsa-miR-2117	CLIP-seq
MIRT737818	hsa-miR-214	CLIP-seq
MIRT2597912	hsa-miR-218	CLIP-seq
MIRT2074248	hsa-miR-221	CLIP-seq
MIRT2074249	hsa-miR-222	CLIP-seq
MIRT2688405	hsa-miR-2276	CLIP-seq
MIRT1251826	hsa-miR-2277-3p	CLIP-seq
MIRT1251827	hsa-miR-23a	CLIP-seq
MIRT1251828	hsa-miR-23b	CLIP-seq
MIRT1251829	hsa-miR-23c	CLIP-seq
MIRT1251830	hsa-miR-301a	CLIP-seq
MIRT1251831	hsa-miR-301b	CLIP-seq
MIRT1251832	hsa-miR-3074-3p	CLIP-seq
MIRT1251833	hsa-miR-30a	CLIP-seq
MIRT1251834	hsa-miR-30b	CLIP-seq
MIRT1251835	hsa-miR-30c	CLIP-seq
MIRT1251836	hsa-miR-30d	CLIP-seq
MIRT1251837	hsa-miR-30e	CLIP-seq
MIRT2597913	hsa-miR-3119	CLIP-seq
MIRT2597914	hsa-miR-3120-5p	CLIP-seq
MIRT2688406	hsa-miR-3121-3p	CLIP-seq
MIRT2597915	hsa-miR-3145-5p	CLIP-seq
MIRT2597916	hsa-miR-3152-5p	CLIP-seq
MIRT2301257	hsa-miR-3153	CLIP-seq
MIRT2597917	hsa-miR-3177-5p	CLIP-seq
MIRT2597918	hsa-miR-3183	CLIP-seq
MIRT2597919	hsa-miR-3201	CLIP-seq
MIRT2688407	hsa-miR-323-3p	CLIP-seq
MIRT2597920	hsa-miR-324-5p	CLIP-seq
MIRT2301259	hsa-miR-338-5p	CLIP-seq
MIRT2597921	hsa-miR-3591-5p	CLIP-seq
MIRT2074250	hsa-miR-3607-3p	CLIP-seq
MIRT2597922	hsa-miR-3613-3p	CLIP-seq
MIRT2597923	hsa-miR-3613-5p	CLIP-seq
MIRT2597924	hsa-miR-3616-5p	CLIP-seq
MIRT1251840	hsa-miR-3647-3p	CLIP-seq
MIRT2597925	hsa-miR-3647-5p	CLIP-seq
MIRT2301260	hsa-miR-3654	CLIP-seq
MIRT2301261	hsa-miR-3664-5p	CLIP-seq
MIRT1251841	hsa-miR-3666	CLIP-seq
MIRT2597926	hsa-miR-3671	CLIP-seq
MIRT2597927	hsa-miR-3692	CLIP-seq
MIRT2688408	hsa-miR-369-3p	CLIP-seq
MIRT2688409	hsa-miR-374a	CLIP-seq
MIRT2688410	hsa-miR-374b	CLIP-seq
MIRT2597928	hsa-miR-3917	CLIP-seq
MIRT2597929	hsa-miR-3927	CLIP-seq
MIRT1251842	hsa-miR-409-3p	CLIP-seq
MIRT2597930	hsa-miR-410	CLIP-seq
MIRT2597931	hsa-miR-4273	CLIP-seq
MIRT2597932	hsa-miR-4280	CLIP-seq
MIRT2597933	hsa-miR-4282	CLIP-seq
MIRT737816	hsa-miR-4291	CLIP-seq
MIRT1251843	hsa-miR-4295	CLIP-seq
MIRT2074253	hsa-miR-4325	CLIP-seq
MIRT2597934	hsa-miR-4436b-5p	CLIP-seq
MIRT2301262	hsa-miR-4480	CLIP-seq
MIRT737812	hsa-miR-4495	CLIP-seq
MIRT2597935	hsa-miR-4528	CLIP-seq
MIRT1251845	hsa-miR-454	CLIP-seq
MIRT2597936	hsa-miR-4650-3p	CLIP-seq
MIRT1251846	hsa-miR-4668-3p	CLIP-seq
MIRT2597937	hsa-miR-4670-3p	CLIP-seq
MIRT1251847	hsa-miR-4671-3p	CLIP-seq
MIRT2597938	hsa-miR-4677-5p	CLIP-seq
MIRT2597939	hsa-miR-4684-3p	CLIP-seq
MIRT2688411	hsa-miR-4686	CLIP-seq
MIRT2597940	hsa-miR-4690-3p	CLIP-seq
MIRT2688412	hsa-miR-4700-3p	CLIP-seq
MIRT2301264	hsa-miR-4714-5p	CLIP-seq
MIRT2597941	hsa-miR-4723-3p	CLIP-seq
MIRT2301265	hsa-miR-4727-5p	CLIP-seq
MIRT2074255	hsa-miR-4753-3p	CLIP-seq
MIRT2597942	hsa-miR-4762-5p	CLIP-seq
MIRT2597943	hsa-miR-4766-3p	CLIP-seq
MIRT2301267	hsa-miR-4769-3p	CLIP-seq
MIRT2688413	hsa-miR-4772-3p	CLIP-seq
MIRT2597944	hsa-miR-4772-5p	CLIP-seq
MIRT2074256	hsa-miR-4778-5p	CLIP-seq
MIRT2688414	hsa-miR-4789-5p	CLIP-seq
MIRT2597945	hsa-miR-4791	CLIP-seq
MIRT2597946	hsa-miR-4795-3p	CLIP-seq
MIRT2597947	hsa-miR-4799-5p	CLIP-seq
MIRT2597948	hsa-miR-4802-3p	CLIP-seq
MIRT1251849	hsa-miR-487a	CLIP-seq
MIRT2301268	hsa-miR-5096	CLIP-seq
MIRT2439579	hsa-miR-511	CLIP-seq
MIRT2597949	hsa-miR-513a-3p	CLIP-seq
MIRT2597950	hsa-miR-518a-5p	CLIP-seq
MIRT2597951	hsa-miR-527	CLIP-seq
MIRT2597952	hsa-miR-548a-5p	CLIP-seq
MIRT2597953	hsa-miR-548ab	CLIP-seq
MIRT2597954	hsa-miR-548ak	CLIP-seq
MIRT2597955	hsa-miR-548b-5p	CLIP-seq
MIRT2074257	hsa-miR-548c-3p	CLIP-seq
MIRT2597956	hsa-miR-548c-5p	CLIP-seq
MIRT2597957	hsa-miR-548d-5p	CLIP-seq
MIRT2597958	hsa-miR-548h	CLIP-seq
MIRT2597959	hsa-miR-548i	CLIP-seq
MIRT2597960	hsa-miR-548j	CLIP-seq
MIRT2597961	hsa-miR-548k	CLIP-seq
MIRT2597962	hsa-miR-548l	CLIP-seq
MIRT2597963	hsa-miR-548p	CLIP-seq
MIRT2074258	hsa-miR-548v	CLIP-seq
MIRT2597964	hsa-miR-548w	CLIP-seq
MIRT2597965	hsa-miR-548y	CLIP-seq
MIRT2597966	hsa-miR-559	CLIP-seq
MIRT2597967	hsa-miR-562	CLIP-seq
MIRT2597968	hsa-miR-573	CLIP-seq
MIRT2688415	hsa-miR-577	CLIP-seq
MIRT2597969	hsa-miR-578	CLIP-seq
MIRT2597970	hsa-miR-593	CLIP-seq
MIRT2597971	hsa-miR-636	CLIP-seq
MIRT2301269	hsa-miR-642a	CLIP-seq
MIRT2597972	hsa-miR-642b	CLIP-seq
MIRT737814	hsa-miR-646	CLIP-seq
MIRT2597973	hsa-miR-654-3p	CLIP-seq
MIRT2597974	hsa-miR-7	CLIP-seq
MIRT737817	hsa-miR-761	CLIP-seq
MIRT2688416	hsa-miR-891b	CLIP-seq
MIRT1552517	hsa-miR-892b	CLIP-seq
MIRT737815	hsa-miR-922	CLIP-seq
MIRT2074260	hsa-miR-944	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
CRTC1	Activation	10893434
MEF2A	Unknown	18222924
MITF	Activation	23416000
TP53	Unknown	19139068

Show/Hide all(120)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IEA
GO:0000422	Process	Autophagy of mitochondrion	IEA
GO:0000785	Component	Chromatin	IC	27471003
GO:0001659	Process	Temperature homeostasis	TAS	1258810
GO:0001678	Process	Cellular glucose homeostasis	NAS	11854298
GO:0001933	Process	Negative regulation of protein phosphorylation	IEA
GO:0002021	Process	Response to dietary excess	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003677	Function	DNA binding	TAS	10713165
GO:0003712	Function	Transcription coregulator activity	TAS	14636573
GO:0003713	Function	Transcription coactivator activity	IDA	19651776, 21376232, 27471003
GO:0003723	Function	RNA binding	TAS	12588810
GO:0005515	Function	Protein binding	IPI	12522104, 15337744, 17050673, 18063693, 18441008, 19171140, 19846556, 19914244, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	23836911
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	12588810
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006012	Process	Galactose metabolic process	IEA
GO:0006094	Process	Gluconeogenesis	NAS	11854298
GO:0006355	Process	Regulation of transcription, DNA-templated	IDA	23836911, 27471003
GO:0006367	Process	Transcription initiation from RNA polymerase II promoter	TAS	14636573
GO:0006397	Process	MRNA processing	TAS	12588810
GO:0007005	Process	Mitochondrion organization	NAS	11854298
GO:0007005	Process	Mitochondrion organization	TAS
GO:0007568	Process	Aging	IEA
GO:0007586	Process	Digestion	TAS	10585775
GO:0007623	Process	Circadian rhythm	TAS
GO:0008134	Function	Transcription factor binding	IBA	21873635
GO:0008134	Function	Transcription factor binding	TAS	12588810
GO:0008209	Process	Androgen metabolic process	IEA
GO:0008380	Process	RNA splicing	TAS	12588810
GO:0009409	Process	Response to cold	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	23525105
GO:0010822	Process	Positive regulation of mitochondrion organization	IMP	25118933
GO:0010822	Process	Positive regulation of mitochondrion organization	ISS
GO:0014732	Process	Skeletal muscle atrophy	IEA
GO:0014850	Process	Response to muscle activity	ISS
GO:0014878	Process	Response to electrical stimulus involved in regulation of muscle adaptation	IEA
GO:0014912	Process	Negative regulation of smooth muscle cell migration	IEA
GO:0016605	Component	PML body	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	18798693
GO:0019395	Process	Fatty acid oxidation	NAS	11854298
GO:0021549	Process	Cerebellum development	IEA
GO:0022626	Component	Cytosolic ribosome	IEA
GO:0022904	Process	Respiratory electron transport chain	ISS
GO:0030331	Function	Estrogen receptor binding	IEA
GO:0030374	Function	Nuclear receptor coactivator activity	IBA	21873635
GO:0030374	Function	Nuclear receptor coactivator activity	IDA	16488887
GO:0030900	Process	Forebrain development	IEA
GO:0031490	Function	Chromatin DNA binding	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	22064484
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034599	Process	Cellular response to oxidative stress	ISS
GO:0035066	Process	Positive regulation of histone acetylation	TAS	14636573
GO:0035865	Process	Cellular response to potassium ion	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042594	Process	Response to starvation	NAS	11854298
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042975	Function	Peroxisome proliferator activated receptor binding	IEA
GO:0043014	Function	Alpha-tubulin binding	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043201	Process	Response to leucine	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	23836911
GO:0045333	Process	Cellular respiration	TAS	11551810
GO:0045722	Process	Positive regulation of gluconeogenesis	TAS	12588810
GO:0045820	Process	Negative regulation of glycolytic process	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	16488887, 19651776
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	21376232
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046321	Process	Positive regulation of fatty acid oxidation	TAS	12588810
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0050821	Process	Protein stabilization	TAS	14636573
GO:0050873	Process	Brown fat cell differentiation	TAS	12588810
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IBA	21873635
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	19651776
GO:0051552	Process	Flavone metabolic process	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	14636573
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071250	Process	Cellular response to nitrite	IEA
GO:0071313	Process	Cellular response to caffeine	IEA
GO:0071332	Process	Cellular response to fructose stimulus	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071354	Process	Cellular response to interleukin-6	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071372	Process	Cellular response to follicle-stimulating hormone stimulus	IEA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071871	Process	Response to epinephrine	IEA
GO:0071873	Process	Response to norepinephrine	IEA
GO:0090258	Process	Negative regulation of mitochondrial fission	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IEA
GO:0097440	Component	Apical dendrite	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	15454086
GO:1901215	Process	Negative regulation of neuron death	IGI	21376232
GO:1901558	Process	Response to metformin	IEA
GO:1901857	Process	Positive regulation of cellular respiration	IEA
GO:1901860	Process	Positive regulation of mitochondrial DNA metabolic process	IEA
GO:1901863	Process	Positive regulation of muscle tissue development	IEA
GO:1904635	Process	Positive regulation of glomerular visceral epithelial cell apoptotic process	IEA
GO:1904637	Process	Cellular response to ionomycin	IEA
GO:1904639	Process	Cellular response to resveratrol	IEA
GO:1904640	Process	Response to methionine	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:1990843	Component	Subsarcolemmal mitochondrion	IEA
GO:1990844	Component	Interfibrillar mitochondrion	IEA
GO:1990845	Process	Adaptive thermogenesis	IEA
GO:2000184	Process	Positive regulation of progesterone biosynthetic process	IEA
GO:2000272	Process	Negative regulation of signaling receptor activity	IEA
GO:2000310	Process	Regulation of NMDA receptor activity	IEA
GO:2001171	Process	Positive regulation of ATP biosynthetic process	ISS

MIM	HGNC	e!Ensembl
604517	9237	ENSG00000109819

Protein

UniProt ID

Q9UBK2

Protein name

Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PGC-1-alpha) (PPAR-gamma coactivator 1-alpha) (PPARGC-1-alpha) (Ligand effect modulator 6)

Protein function

Transcriptional coactivator for steroid receptors and nuclear receptors (PubMed:10713165, PubMed:20005308, PubMed:21376232, PubMed:28363985, PubMed:32433991). Greatly increases the transcriptional activity of PPARG and thyroid hormone receptor o

PDB

1XB7 , 3B1M , 3CS8 , 3D24 , 3U9Q , 3V9T , 3V9V , 4QJR , 4QK4 , 5Q0I , 5TWO , 5UNJ , 5Z5S , 5Z6S , 6AD9 , 6FZF , 6FZP , 6IZM , 6IZN , 6K0T , 6KXX , 6KXY , 6LN4 , 6MS7 , 6NWK , 6NWL , 6T1V , 6W9K , 6W9L , 7E2E , 7KHT , 7PRV , 7PRW , 7PRX , 8BF1 , 8DK4 , 9F7W , 9F7X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	679 → 742	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, skeletal muscle, liver and kidney. Expressed at lower levels in brain and pancreas and at very low levels in the intestine and white adipose tissue. In skeletal muscle, levels were lower in obese than in lean subjects and fastin

Sequence

MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
KSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK
SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
TGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC
SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE
RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI
TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY
DSLDFDSLLKEAQRSLRR

Sequence length

798

Interactions

View interactions

Show/Hide Unknown Diseases (8)

Disease term	Disease name	Evidence	Source
Unknown
Schizophrenia	Schizophrenia		GWAS
Gout	Gout		GWAS
Pulmonary Emphysema	Pulmonary Emphysema		GWAS
Neuroticism	Neuroticism		GWAS
Tremor	Tremor		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Diabetes	Diabetes		GWAS

Show/Hide Text Mining Associations (211)

Disease Name	Relationship Type	References
Associations from Text Mining
Acidosis	Inhibit	26656911
Acute Kidney Injury	Associate	29268263
Adenocarcinoma	Associate	36103249
Adenocarcinoma Follicular	Associate	21454643
Adenocarcinoma of Lung	Associate	25331784
Adrenal Hyperplasia Congenital	Associate	34373561
AIDS Associated Nephropathy	Inhibit	31238091
Alopecia	Associate	35279334
Alzheimer Disease	Inhibit	22077634
Alzheimer Disease	Associate	31081111, 31283791, 40642087
Amyotrophic Lateral Sclerosis	Associate	25892363
Amyotrophic Lateral Sclerosis	Stimulate	28005993
Ascites	Stimulate	36012230
Atherosclerosis	Associate	19322023
Atrophy	Inhibit	22272266
Autism Spectrum Disorder	Associate	37407249
Bantu siderosis	Associate	30920960
Benign Paroxysmal Positional Vertigo	Inhibit	27203679
Bipolar Disorder	Associate	27324142
Birt Hogg Dube Syndrome	Associate	21162720
Bone Diseases	Inhibit	30075123
Bovine Respiratory Disease Complex	Stimulate	35577908
Bowen's Disease	Stimulate	21514422
Breast Neoplasms	Associate	22234241, 22703186, 23172368, 24403067, 27746856, 36069230, 36114448
Bulbo Spinal Atrophy X Linked	Stimulate	28005993
Carcinogenesis	Inhibit	18242180
Carcinogenesis	Associate	21855427, 28051997
Carcinoma Hepatocellular	Associate	16891307, 19793803, 20044617, 26380295, 33910445, 34981667, 37903974, 38019226
Carcinoma Hepatocellular	Inhibit	18242180, 28381162, 33276082
Carcinoma in Situ	Associate	32801084
Carcinoma Non Small Cell Lung	Associate	30880247, 31713888, 36430689
Carcinoma Ovarian Epithelial	Associate	21447778, 25243473
Carcinoma Renal Cell	Associate	25243473, 30406665, 34870494, 37940720
Carcinoma Squamous Cell	Associate	37856813
Cardiomegaly	Associate	36378046
Cardiomyopathies	Inhibit	32460327
Cardiomyopathy Restrictive	Stimulate	18791640
Cardiovascular Diseases	Associate	18162502, 25923461
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	34373561
Cerebral Palsy	Inhibit	34176131
Cerebrovascular Disorders	Stimulate	28533333
Colitis Ulcerative	Associate	33686088
Colonic Neoplasms	Associate	32744303, 37023088, 37543674
Colorectal Neoplasms	Associate	17341490, 28051997, 29973580, 30959809, 32828126, 34080453, 34169901, 34702278, 35792657, 35896535, 39210159
Composite Lymphoma	Associate	32867330
Congenital Hyperinsulinism	Stimulate	20699619
Coronary Artery Disease	Inhibit	27542888, 28533333
Coronary Disease	Inhibit	27542888
COVID 19	Inhibit	34076249
Crisponi syndrome	Stimulate	27486743
Cytochrome c Oxidase Deficiency	Associate	19297390
Death	Associate	15705733
Delayed Graft Function	Associate	29268263
Demyelinating Diseases	Stimulate	25492529
Depressive Disorder	Associate	32998701
Diabetes Gestational	Inhibit	25437179
Diabetes Mellitus	Associate	12397057, 15705733, 16326070, 16538490, 18162502, 19077249, 19723495, 22174922, 22955979, 24317794, 27542888, 27699582, 32867330, 36594575, 36768561, 36835287 View all (1 more)
Diabetes Mellitus	Inhibit	12832613, 28864016
Diabetes Mellitus Type 2	Inhibit	15545992, 16326070, 17327455, 27542888, 31015797
Diabetes Mellitus Type 2	Associate	15546003, 15581067, 15705733, 16403952, 16538490, 17216277, 18162502, 18614852, 19723495, 20032281, 22684233, 22955979, 23133645, 23251491, 23505498 View all (15 more)
Diabetes Mellitus Type 2	Stimulate	23805175
Diabetic Foot	Associate	26579581
Diabetic Nephropathies	Inhibit	23949796, 27825100
Diabetic Retinopathy	Associate	29115286
DiGeorge Syndrome	Associate	34009292
Down Syndrome	Associate	23291000
Drug Related Side Effects and Adverse Reactions	Associate	20860658, 25099937, 25961951, 29288336, 32452827
Dyslipidemias	Associate	32867330
Endometriosis	Associate	39244839
Essential Tremor	Associate	27797806, 28801652
Familial Primary Pulmonary Hypertension	Associate	22973467, 25815108
Fatty Liver	Associate	17216277, 26999124, 27015186, 34321850
Fetal Growth Retardation	Associate	26051094
Fibrosarcoma	Associate	39681411
Fibrosis	Associate	30130620, 31614978, 37852548
Fibrosis	Inhibit	30391585
Fluorosis Dental	Associate	39350036
Friedreich Ataxia	Associate	21687738
Gallbladder Neoplasms	Associate	34184087
Gardner Syndrome	Stimulate	27444220
Glioblastoma	Associate	28076790, 30578297
Glioma	Associate	30578297
Glucose Intolerance	Associate	16403952
Glucose Intolerance	Stimulate	19504086
Glycogen Storage Disease Type II	Associate	32051464
Heart Diseases	Associate	21687738, 32460327
Heart Failure	Associate	12397057, 19061896, 24704539, 32460327
Heart Failure	Inhibit	24825877, 28824327
Hemorrhoids	Associate	37932969
Hepatitis B	Associate	25762623
Hereditary Autoinflammatory Diseases	Associate	23792589
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	37181035
Heredodegenerative Disorders Nervous System	Associate	33804860
HIV Infections	Associate	31714428
Huntington Disease	Associate	19118529, 22825315, 24383721, 36902304
Hyperglycemia	Associate	27340502
Hyperglycemia	Inhibit	28433632
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	36835287
Hypertension	Associate	17971240, 18614852, 19077249
Hypertension	Stimulate	28824327
Hypoglycemia	Associate	28591028
Hypoxia	Stimulate	22973467
Hypoxia	Associate	30578297, 36429023
Hypoxia	Inhibit	35692078
Hypoxia Brain	Associate	36429023
Hypoxia Ischemia Brain	Associate	34098747
Inflammation	Inhibit	25492529, 30138744
Inflammation	Associate	28051997, 34375639
Insulin Resistance	Associate	12832613, 16326070, 16403952, 19966034, 20739510, 24317794, 25282005, 27955950, 35205333, 37730054
Insulin Resistance	Inhibit	17563058, 18182465, 21266331, 21701566, 22323564
Kidney Diseases	Associate	22684233
Kidney Failure Chronic	Associate	33790861
Kidney Neoplasms	Associate	21162720
Leigh Disease	Associate	33771987
Leukemia	Associate	37932969
Lipoma	Associate	21078971
Lung Neoplasms	Inhibit	34076249
Lung Neoplasms	Associate	35897813
Lymphoma Large B Cell Diffuse	Associate	37716978
Macular Degeneration	Associate	27998274
Macular Degeneration	Stimulate	28600982
Malignant Teratocarcinosarcoma	Associate	37378830
Melanoma	Inhibit	23477830
Melanoma	Associate	29665239, 31461993, 37277330, 37758066
Mental Disorders	Associate	26683626
MERRF Syndrome	Associate	35922766
Metabolic Diseases	Associate	17563058, 22848045, 28346099, 28864016, 33946753, 36292779, 37171500, 37679383
Metabolic Syndrome	Associate	28346099, 32867330
Mitochondrial Diseases	Inhibit	18182465, 22077634
Mitochondrial Diseases	Associate	18332166, 19061896, 19297390, 24290359, 25961951, 27998274, 29288336, 29888964, 31081111, 31480724, 32377739, 32452827, 32947930, 33019842, 33268822 View all (8 more)
Mitochondrial Encephalomyopathies	Associate	19297390
Multiple Sclerosis	Associate	25492529, 35008743
Multiple Sclerosis	Inhibit	30063300
Muscle Neoplasms	Associate	25531450, 25886402, 28869034, 29687616
Muscular Atrophy	Associate	21171097, 35563712
Muscular Atrophy	Inhibit	23284670
Muscular Disorders Atrophic	Associate	22272266
Muscular Disorders Atrophic	Inhibit	23284670
Muscular Dystrophy Duchenne	Associate	22319435
Muscular Dystrophy Facioscapulohumeral	Associate	30462217
Myocardial Bridging	Associate	34726081
Myotonic Dystrophy	Inhibit	27542888
Myotonic Dystrophy	Associate	28591028
Nasopharyngeal Carcinoma	Associate	30945396
Neoplasm Invasiveness	Associate	32801084
Neoplasm Metastasis	Associate	28597070, 35896535, 36069230
Neoplasms	Inhibit	21385932, 28381162, 33276082
Neoplasms	Associate	22234241, 23852949, 27746856, 28453464, 29436167, 29888964, 30318520, 30578297, 30920960, 31040369, 33628590, 33910445, 34546848, 35444287, 36012230 View all (9 more)
Neoplasms Adipose Tissue	Associate	24317794, 32933059, 34726081
Neoplasms Glandular and Epithelial	Associate	39307374
Nerve Degeneration	Associate	33149812
Nerve Degeneration	Inhibit	37526811
Neurodegenerative Diseases	Associate	24383721, 25099937, 33804860, 37679383
Neurodegenerative Diseases	Inhibit	25492529
Neuroinflammatory Diseases	Associate	34511122
Neurologic Manifestations	Associate	19118529
Non alcoholic Fatty Liver Disease	Associate	18588668, 23269818, 23931760, 27015186, 31390852, 32297157, 34321850
Obesity	Associate	14740316, 16403952, 17216277, 18614852, 19077249, 19966034, 21817823, 22106445, 22253914, 23269818, 23583180, 25923461, 26185753, 26386696, 27699582 View all (9 more)
Obesity	Stimulate	21190973, 24141239, 28824327
Obesity	Inhibit	25370852, 25975200
Obesity Morbid	Associate	21904299, 30138744
Oropharyngeal Neoplasms	Associate	36134662
Osteoarthritis	Associate	37935325
Osteoglophonic dwarfism	Associate	33149812
Osteoporosis	Associate	30075123
Osteosarcoma	Associate	17341490, 31097683
Oto palato digital syndrome type 2	Inhibit	35905946
Ovarian Neoplasms	Associate	27271583, 31657115, 33294122, 33802591, 33921111, 35577908, 36012230
Overweight	Associate	28453464, 29140431, 36466447
Parkinson Disease	Associate	19374590, 21215313, 21595954, 23939409, 24290359, 24582596, 28972555, 29630901, 29986767, 30934776, 31930701, 32452827, 32591623, 33804860
Pediatric Obesity	Associate	36466447
Pelvic Organ Prolapse	Associate	31307745
Peripheral Nerve Injuries	Stimulate	37526811
Peritonitis	Inhibit	24204994
Plaque Amyloid	Associate	31283791
Polycystic Ovary Syndrome	Inhibit	17563058
Polycystic Ovary Syndrome	Associate	27889100, 38131196
Pre Eclampsia	Inhibit	26051094
Prediabetic State	Inhibit	15545992
Prodromal Symptoms	Associate	29192176
Prostatic Neoplasms	Associate	19884383, 28453464, 32377739, 33230156, 33934205, 37061917
Prostatic Neoplasms Castration Resistant	Associate	19884383
Pseudomonas Infections	Associate	31417101
Pulmonary Arterial Hypertension	Associate	22973467
Pulmonary Disease Chronic Obstructive	Associate	17459894, 22815389, 34831227, 38320732
Pulmonary Disease Chronic Obstructive	Inhibit	40655182
Rectal Neoplasms	Associate	28051997
Renal Insufficiency Chronic	Associate	26579581, 31083336, 31614978
Respiratory Insufficiency	Associate	21454643
Retinal Diseases	Associate	27998274
Ring Chromosome 20 Syndrome	Associate	33149812
Sarcopenia	Associate	31862890, 38320732
Schizophrenia	Associate	26683626
Sebaceous Gland Neoplasms	Associate	36735267
Sleep Apnea Obstructive	Inhibit	35692078
Smooth Muscle Tumor	Associate	38012555
Spinal Cord Injuries	Associate	31869286
Squamous Cell Carcinoma of Head and Neck	Associate	32801084, 36037136
Stomach Neoplasms	Associate	36587194
Stroke	Associate	19297390
Takotsubo Cardiomyopathy	Associate	27015186
Thyroid Neoplasms	Associate	27494611, 30069928, 34167437
Thyrotropin Biologically Inactive	Inhibit	16326070
Triple Negative Breast Neoplasms	Inhibit	36114448
Vascular Calcification	Associate	38012555
Vascular Diseases	Associate	26191154
Ventricular Dysfunction Left	Associate	19077249
Vitiligo	Associate	28502800, 29057950, 31037127
Weight Gain	Associate	29554135
Weight Loss	Associate	23583180
Wolf Hirschhorn Syndrome	Stimulate	36980907

PPARGC1A (PPARG coactivator 1 alpha)