Gene Gene information from NCBI Gene database.
Entrez ID 5467
Gene name Peroxisome proliferator activated receptor delta
Gene symbol PPARD
Synonyms (NCBI Gene)
FAARNR1C2NUC1NUCINUCIIPPARB
Chromosome 6
Chromosome location 6p21.31
Summary This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcr
miRNA miRNA information provided by mirtarbase database.
268
miRTarBase ID miRNA Experiments Reference
MIRT049777 hsa-miR-92a-3p CLASH 23622248
MIRT043275 hsa-miR-331-3p CLASH 23622248
MIRT053749 hsa-miR-29b-3p Microarray 22942087
MIRT439926 hsa-miR-218-5p HITS-CLIP 23212916
MIRT439926 hsa-miR-218-5p HITS-CLIP 23212916
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
CTNNB1 Unknown 17724465
JUN Activation 18625220
RELA Repression 14708613
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
124
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600409 9235 ENSG00000112033
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q03181
Protein name Peroxisome proliferator-activated receptor delta (PPAR-delta) (NUCI) (Nuclear hormone receptor 1) (NUC1) (Nuclear receptor subfamily 1 group C member 2) (Peroxisome proliferator-activated receptor beta) (PPAR-beta)
Protein function Ligand-activated transcription factor key mediator of energy metabolism in adipose tissues (PubMed:35675826). Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty a
PDB 1GWX , 1Y0S , 2AWH , 2B50 , 2BAW , 2ENV , 2GWX , 2J14 , 2Q5G , 2XYJ , 2XYW , 2XYX , 2ZNP , 2ZNQ , 3D5F , 3DY6 , 3ET2 , 3GWX , 3GZ9 , 3OZ0 , 3PEQ , 3SP9 , 3TKM , 5U3Q , 5U3R , 5U3S , 5U3T , 5U3U , 5U3V , 5U3W , 5U3X , 5U3Y , 5U3Z , 5U40 , 5U41 , 5U42 , 5U43 , 5U44 , 5U45 , 5U46 , 5XMX , 5Y7X , 5ZXI , 6A6P , 7F80 , 7VWE , 7VWF , 7VWG , 7VWH , 7W0G , 7WGL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 72 140 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 236 422 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous with maximal levels in placenta and skeletal muscle.
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSH
NAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KK
TETETSLHPLLQEIYKDMY
Sequence length 441
Interactions View interactions