Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5467
Gene name Gene Name - the full gene name approved by the HGNC.
Peroxisome proliferator activated receptor delta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PPARD
Synonyms (NCBI Gene) Gene synonyms aliases
FAAR, NR1C2, NUC1, NUCI, NUCII, PPARB
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) family. The encoded protein is thought to function as an integrator of transcriptional repression and nuclear receptor signaling. It may inhibit the ligand-induced transcr
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049777 hsa-miR-92a-3p CLASH 23622248
MIRT043275 hsa-miR-331-3p CLASH 23622248
MIRT053749 hsa-miR-29b-3p Microarray 22942087
MIRT439926 hsa-miR-218-5p HITS-CLIP 23212916
MIRT439926 hsa-miR-218-5p HITS-CLIP 23212916
Transcription factors
Transcription factor Regulation Reference
CTNNB1 Unknown 17724465
JUN Activation 18625220
RELA Repression 14708613
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600409 9235 ENSG00000112033
Protein
UniProt ID Q03181
Protein name Peroxisome proliferator-activated receptor delta (PPAR-delta) (NUCI) (Nuclear hormone receptor 1) (NUC1) (Nuclear receptor subfamily 1 group C member 2) (Peroxisome proliferator-activated receptor beta) (PPAR-beta)
Protein function Ligand-activated transcription factor key mediator of energy metabolism in adipose tissues (PubMed:35675826). Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty a
PDB 1GWX , 1Y0S , 2AWH , 2B50 , 2BAW , 2ENV , 2GWX , 2J14 , 2Q5G , 2XYJ , 2XYW , 2XYX , 2ZNP , 2ZNQ , 3D5F , 3DY6 , 3ET2 , 3GWX , 3GZ9 , 3OZ0 , 3PEQ , 3SP9 , 3TKM , 5U3Q , 5U3R , 5U3S , 5U3T , 5U3U , 5U3V , 5U3W , 5U3X , 5U3Y , 5U3Z , 5U40 , 5U41 , 5U42 , 5U43 , 5U44 , 5U45 , 5U46 , 5XMX , 5Y7X , 5ZXI , 6A6P , 7F80 , 7VWE , 7VWF , 7VWG , 7VWH , 7W0G , 7WGL
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 72 140 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 236 422 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous with maximal levels in placenta and skeletal muscle.
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSH
NAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KK
TETETSLHPLLQEIYKDMY
Sequence length 441
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Cataracts in type 2 diabetes N/A N/A GWAS
Gout Gout N/A N/A GWAS
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abidi X linked mental retardation syndrome Associate 28737528
Acidosis Inhibit 32900990
Adenocarcinoma of Lung Associate 33637678
Adenomatous Polyposis Coli Associate 11226285
Adenomatous Polyps Stimulate 16969348
Alzheimer Disease Associate 31884472
Anophthalmia with pulmonary hypoplasia Associate 26578390
Anorchia Inhibit 26431381
Astrocytoma Associate 32198386
Atherosclerosis Associate 20645257, 28128413