Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	5371
Gene name	PML nuclear body scaffold
Gene symbol	PML
Synonyms (NCBI Gene)	MYLPP8675RNF71TRIM19
Chromosome	15
Chromosome location	15q24.1
Summary	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This phosphoprotein localizes to nuclear bodies wh

165

Show/Hide all (165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018318	hsa-miR-335-5p	Microarray	18185580
MIRT043919	hsa-miR-378a-3p	CLASH	23622248
MIRT042535	hsa-miR-423-3p	CLASH	23622248
MIRT042535	hsa-miR-423-3p	CLASH	23622248
MIRT1244408	hsa-miR-1227	CLIP-seq
MIRT1244409	hsa-miR-124	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT1244410	hsa-miR-1321	CLIP-seq
MIRT1244411	hsa-miR-2113	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT1244412	hsa-miR-3065-5p	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT1244413	hsa-miR-3156-5p	CLIP-seq
MIRT1244414	hsa-miR-3173-3p	CLIP-seq
MIRT1244415	hsa-miR-3180-5p	CLIP-seq
MIRT1244416	hsa-miR-3194-3p	CLIP-seq
MIRT1244417	hsa-miR-3202	CLIP-seq
MIRT1244418	hsa-miR-3920	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT1244419	hsa-miR-4325	CLIP-seq
MIRT1244420	hsa-miR-4419a	CLIP-seq
MIRT1244421	hsa-miR-4510	CLIP-seq
MIRT1244422	hsa-miR-4533	CLIP-seq
MIRT1244423	hsa-miR-4536	CLIP-seq
MIRT1244424	hsa-miR-455-5p	CLIP-seq
MIRT1244425	hsa-miR-4688	CLIP-seq
MIRT1244426	hsa-miR-4739	CLIP-seq
MIRT1244427	hsa-miR-4756-5p	CLIP-seq
MIRT1244428	hsa-miR-4762-3p	CLIP-seq
MIRT1244429	hsa-miR-4779	CLIP-seq
MIRT1244430	hsa-miR-486-3p	CLIP-seq
MIRT1244431	hsa-miR-506	CLIP-seq
MIRT1244432	hsa-miR-513a-3p	CLIP-seq
MIRT1244433	hsa-miR-520a-5p	CLIP-seq
MIRT1244434	hsa-miR-525-5p	CLIP-seq
MIRT1244435	hsa-miR-569	CLIP-seq
MIRT1244436	hsa-miR-659	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT1244417	hsa-miR-3202	CLIP-seq
MIRT1244422	hsa-miR-4533	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT1244417	hsa-miR-3202	CLIP-seq
MIRT2072199	hsa-miR-4313	CLIP-seq
MIRT2072200	hsa-miR-4492	CLIP-seq
MIRT2072201	hsa-miR-4498	CLIP-seq
MIRT1244422	hsa-miR-4533	CLIP-seq
MIRT2072202	hsa-miR-4645-5p	CLIP-seq
MIRT2072203	hsa-miR-4667-3p	CLIP-seq
MIRT2072204	hsa-miR-4673	CLIP-seq
MIRT2072205	hsa-miR-4675	CLIP-seq
MIRT2072206	hsa-miR-4685-5p	CLIP-seq
MIRT2072207	hsa-miR-4741	CLIP-seq
MIRT2072208	hsa-miR-4742-5p	CLIP-seq
MIRT2072209	hsa-miR-4776-3p	CLIP-seq
MIRT2072210	hsa-miR-762	CLIP-seq
MIRT2299469	hsa-miR-1293	CLIP-seq
MIRT2299470	hsa-miR-1298	CLIP-seq
MIRT2299471	hsa-miR-323-5p	CLIP-seq
MIRT2299472	hsa-miR-342-5p	CLIP-seq
MIRT2299473	hsa-miR-3689a-3p	CLIP-seq
MIRT2299474	hsa-miR-3689c	CLIP-seq
MIRT2299475	hsa-miR-4446-3p	CLIP-seq
MIRT2299476	hsa-miR-4483	CLIP-seq
MIRT2072200	hsa-miR-4492	CLIP-seq
MIRT2072201	hsa-miR-4498	CLIP-seq
MIRT2299477	hsa-miR-4505	CLIP-seq
MIRT2072202	hsa-miR-4645-5p	CLIP-seq
MIRT2299478	hsa-miR-4651	CLIP-seq
MIRT2299479	hsa-miR-4664-5p	CLIP-seq
MIRT2072204	hsa-miR-4673	CLIP-seq
MIRT2299480	hsa-miR-4721	CLIP-seq
MIRT2299481	hsa-miR-4728-5p	CLIP-seq
MIRT2299482	hsa-miR-4731-5p	CLIP-seq
MIRT2299483	hsa-miR-608	CLIP-seq
MIRT2299484	hsa-miR-664	CLIP-seq
MIRT2072210	hsa-miR-762	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT2072199	hsa-miR-4313	CLIP-seq
MIRT2072202	hsa-miR-4645-5p	CLIP-seq
MIRT2072203	hsa-miR-4667-3p	CLIP-seq
MIRT2072204	hsa-miR-4673	CLIP-seq
MIRT2072208	hsa-miR-4742-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT737808	hsa-miR-1265	CLIP-seq
MIRT737804	hsa-miR-1303	CLIP-seq
MIRT737809	hsa-miR-2392	CLIP-seq
MIRT737807	hsa-miR-3123	CLIP-seq
MIRT737810	hsa-miR-3137	CLIP-seq
MIRT737805	hsa-miR-3154	CLIP-seq
MIRT737806	hsa-miR-3925-5p	CLIP-seq
MIRT737811	hsa-miR-942	CLIP-seq
MIRT2596116	hsa-miR-1914	CLIP-seq
MIRT2596117	hsa-miR-2114	CLIP-seq
MIRT2596118	hsa-miR-339-5p	CLIP-seq
MIRT2596119	hsa-miR-4676-5p	CLIP-seq
MIRT2596120	hsa-miR-575	CLIP-seq
MIRT2688245	hsa-miR-1	CLIP-seq
MIRT2688246	hsa-miR-1253	CLIP-seq
MIRT2688247	hsa-miR-1255a	CLIP-seq
MIRT2688248	hsa-miR-1255b	CLIP-seq
MIRT2688249	hsa-miR-1264	CLIP-seq
MIRT2688250	hsa-miR-132	CLIP-seq
MIRT2688251	hsa-miR-206	CLIP-seq
MIRT2688252	hsa-miR-212	CLIP-seq
MIRT2688253	hsa-miR-3673	CLIP-seq
MIRT2688254	hsa-miR-4300	CLIP-seq
MIRT2688255	hsa-miR-4633-3p	CLIP-seq
MIRT2688256	hsa-miR-613	CLIP-seq
MIRT2688257	hsa-miR-920	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
ARID3A	Activation	22010578
IRF9	Activation	8681971
PML	Activation	15529177
STAT1	Activation	21115099;22589541
STAT1	Unknown	15519999
STAT2	Unknown	17062732
TP53	Activation	14992722

146

Show/Hide all (146)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000781	Component	Chromosome, telomeric region	IDA	26119943
GO:0001666	Process	Response to hypoxia	IDA	16915281
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	IMP	16873256, 16873257
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	11080164, 15626733
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	9294197, 9448006, 9570750, 9885291, 10597310, 10610177, 10669754, 10684855, 10938104, 11080164, 11259576, 11500381, 11948183, 12006491, 12402044, 12529400, 12773567, 12915590, 14517282, 14976184, 15195100, 15467728, 15626733, 16322229, 16501113, 16873060, 16915281, 17036045, 1829879
GO:0005634	Component	Nucleus	IDA	9294197, 9412458, 16778193, 22274616
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA	12915590
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA	15195100, 16778193
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	9885291, 16778193, 18298799
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006338	Process	Chromatin remodeling	IDA	11259576
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	23007646
GO:0006605	Process	Protein targeting	IDA	11080164
GO:0006605	Process	Protein targeting	IMP	15195100
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006915	Process	Apoptotic process	IDA	9583681
GO:0006915	Process	Apoptotic process	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IEA
GO:0008270	Function	Zinc ion binding	IDA	7729428
GO:0008270	Function	Zinc ion binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	12006491
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IDA	12402044
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0009411	Process	Response to UV	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010522	Process	Regulation of calcium ion transport into cytosol	IEA
GO:0010522	Process	Regulation of calcium ion transport into cytosol	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010761	Process	Fibroblast migration	IEA
GO:0016020	Component	Membrane	IEA
GO:0016363	Component	Nuclear matrix	IDA	11080164
GO:0016363	Component	Nuclear matrix	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	16915281
GO:0016605	Component	PML body	IBA
GO:0016605	Component	PML body	IDA	9412458, 9448006, 9885291, 10910364, 11331580, 12917339, 15195100, 17081985, 22155184, 22869143, 23007646, 23431171, 36373674
GO:0016605	Component	PML body	IEA
GO:0016605	Component	PML body	TAS	9230084
GO:0016740	Function	Transferase activity	IEA
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	TAS
GO:0019789	Function	SUMO transferase activity	EXP	12393906, 20972456
GO:0019789	Function	SUMO transferase activity	IBA
GO:0030099	Process	Myeloid cell differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	7935403, 9395203, 9448006, 9583681
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	ISS
GO:0030578	Process	PML body organization	IDA	8643677, 10779416
GO:0030578	Process	PML body organization	IEA
GO:0030578	Process	PML body organization	IEA
GO:0030578	Process	PML body organization	IMP	17081985
GO:0031503	Process	Protein-containing complex localization	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	12915590
GO:0031901	Component	Early endosome membrane	IEA
GO:0031965	Component	Nuclear membrane	IDA	16778193
GO:0032183	Function	SUMO binding	IPI	17081985
GO:0032206	Process	Positive regulation of telomere maintenance	IMP	22641345, 26119943
GO:0032211	Process	Negative regulation of telomere maintenance via telomerase	IMP	19567472
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	ISS
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IEA
GO:0032692	Process	Negative regulation of interleukin-1 production	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032938	Process	Negative regulation of translation in response to oxidative stress	IDA	16915281
GO:0034097	Process	Response to cytokine	IDA	9412458
GO:0034097	Process	Response to cytokine	IEA
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	ISS
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042803	Function	Protein homodimerization activity	IPI	9230084
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	22406621
GO:0044790	Process	Suppression of viral release by host	IBA
GO:0044790	Process	Suppression of viral release by host	IDA	18248090
GO:0044790	Process	Suppression of viral release by host	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	18248090
GO:0045087	Process	Innate immune response	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045184	Process	Establishment of protein localization	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	7935403, 9448006, 11259576, 22002537
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045930	Process	Negative regulation of mitotic cell cycle	IDA	9395203
GO:0046332	Function	SMAD binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	7935403
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050821	Process	Protein stabilization	IDA	12773567
GO:0050897	Function	Cobalt ion binding	IDA	7729428
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0051457	Process	Maintenance of protein location in nucleus	IDA	17332504
GO:0051607	Process	Defense response to virus	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	9583681, 12773567
GO:0060058	Process	Positive regulation of apoptotic process involved in mammary gland involution	IDA	11080164
GO:0060090	Function	Molecular adaptor activity	IDA	20719947
GO:0060341	Process	Regulation of cellular localization	IEA
GO:0060395	Process	SMAD protein signal transduction	IEA
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0061659	Function	Ubiquitin-like protein ligase activity	IBA
GO:0065003	Process	Protein-containing complex assembly	IDA	12915590
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0071353	Process	Cellular response to interleukin-4	IEA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IEA
GO:0090398	Process	Cellular senescence	IDA	22002537, 22117195, 23431171
GO:0090398	Process	Cellular senescence	IEA
GO:0090402	Process	Oncogene-induced cell senescence	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:1901798	Process	Positive regulation of signal transduction by p53 class mediator	IEA
GO:1904816	Process	Positive regulation of protein localization to chromosome, telomeric region	IDA	22641345
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IMP	15195100
GO:2000779	Process	Regulation of double-strand break repair	IMP	21639834
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IMP	21803845

MIM	HGNC	e!Ensembl
102578	9113	ENSG00000140464

P29590

Protein name

Protein PML (E3 SUMO-protein ligase PML) (EC 2.3.2.-) (Promyelocytic leukemia protein) (RING finger protein 71) (RING-type E3 SUMO transferase PML) (Tripartite motif-containing protein 19) (TRIM19)

Protein function

Functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms. A

PDB

1BOR , 2MVW , 2MWX , 4WJN , 4WJO , 5YUF , 6IMQ , 6UYO , 6UYP , 6UYQ , 6UYR , 6UYS , 6UYT , 6UYU , 6UYV , 8DJH , 8DJI , 8J25 , 8J2P , 8YTC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00643	zf-B_box	124 → 166	B-box zinc finger	Domain
PF12126	DUF3583	240 → 570	Protein of unknown function (DUF3583)	Family

Sequence

MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
NSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL
ADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQ
HFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPG
ASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFAS
LQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA
FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS

Sequence length

882

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Breast ductal adenocarcinoma	Uncertain significance	rs780746013	RCV000207284
Malignant tumor of urinary bladder	Uncertain significance	rs140050477	RCV005931252
PML-related disorder	Likely benign; Benign	rs141646523, rs78340702, rs111658103, rs140216915, rs148636537, rs111398700, rs743582, rs780737061, rs556426526, rs743580, rs743581, rs112272650	RCV003931861 RCV003961553 RCV003949822 RCV003959292 RCV003914555 RCV003922241 RCV003981960 RCV003957414 RCV003968941 RCV003972733 RCV003972734 RCV003916180

Show/Hide Text Mining Associations (100)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute erythroleukemia	Associate	11552979
Acute Retroviral Syndrome	Associate	15589835, 26566030
Adenoviridae Infections	Associate	7559785
Alternating hemiplegia of childhood	Associate	21037079, 23260199, 24413054, 24709898, 25259924, 30226859, 31278054
Alzheimer Disease	Associate	26444770
Aortic Dissection	Associate	33083483
Arthritis Rheumatoid	Associate	17360386
Ataxia	Associate	10669754
Blood Coagulation Disorders	Associate	20133705
Brain Neoplasms	Associate	24487962
Breast Neoplasms	Associate	18039859, 20180533, 24375252, 26383972, 29114882, 30927552, 31506431, 37518985
Bronchial Diseases	Associate	37150829
Calcinosis Cutis	Associate	27662660
Carcinogenesis	Associate	26383972, 31506431, 38066546, 7858248
Carcinoma Ductal	Associate	36765396
Carcinoma Hepatocellular	Associate	11511788, 18609705, 25892518
Carcinoma Pancreatic Ductal	Associate	34570619
Carcinoma Renal Cell	Associate	33173411
Cardiomegaly	Associate	36778116
Celiac Disease	Associate	22136669
Cell Transformation Viral	Associate	28740552
Colorectal Neoplasms	Associate	32737302
Coronary Artery Disease	Associate	25328121
Cytomegalovirus Infections	Associate	36233232
Disease	Associate	21205865
Drug Related Side Effects and Adverse Reactions	Associate	18609705
Endometrial Neoplasms	Associate	15111320
Fanconi Anemia	Associate	34360546
Fibrosis	Associate	36778116
Gallbladder Neoplasms	Associate	18158568
Ganglioneuroblastoma	Associate	31698611
Ganglioneuroma	Associate	31698611
Gastrointestinal Stromal Tumors	Inhibit	25457157
Glioblastoma	Associate	10576656, 18812519, 28526854, 34208139
Glioma	Associate	24487962, 35562901, 38066546
Heart Diseases	Stimulate	36778116
Heart Failure	Associate	36778116
Hematologic Diseases	Associate	9680345
Hematologic Neoplasms	Associate	37382966
Hepatitis B	Stimulate	11511788
Herpes Simplex	Associate	16873256
Histiocytoma Malignant Fibrous	Associate	19025608
HIV Infections	Associate	16188970, 26566030
Hodgkin Disease	Associate	24009715
Hypoxia	Associate	37518985
Hypoxia Brain	Associate	37518985
Infections	Associate	16154611, 19523662, 22205733, 24453968, 26566030, 31456950, 35699431, 35891458
Inflammation	Associate	22947142, 26383972, 37108469, 40595914
Influenza Human	Stimulate	34046815
Leukemia	Associate	10233977, 10882117, 11318028, 1372989, 15729358, 18650449, 19451220, 21613260, 24886876, 28740552, 35963522, 37382966, 38066546, 7620182, 7858248, 8514604, 9531570, 9593784, 9716606 View all (4 more)
Leukemia Lymphocytic Chronic B Cell	Associate	31152142
Leukemia Lymphoma Adult T Cell	Associate	25395419
Leukemia Megakaryoblastic Acute	Associate	22296450
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	24886876, 35963522
Leukemia Myeloid	Associate	24886876
Leukemia Myeloid Acute	Associate	10233384, 10942402, 11552979, 15729358, 16630339, 21738341, 23547873, 23941359, 24886876, 27626703, 28740552, 34047175, 35995769, 36536122, 37925056, 7620182 View all (1 more)
Leukemia Promyelocytic Acute	Associate	10029573, 10233384, 10553155, 10627441, 10669754, 10942370, 10942402, 11050004, 11161223, 11243468, 11301322, 11313457, 11318028, 11378661, 11438209 View all (138 more)
Leukemia Promyelocytic Acute	Inhibit	19011377
Liposarcoma	Associate	19025608
Liver Cirrhosis	Associate	11511788
Lung Diseases	Associate	28332630
Lung Neoplasms	Associate	37150829
Lupus Erythematosus Systemic	Associate	31790472, 36765396
Lymphoproliferative Disorders	Associate	24377530
Melanoma	Associate	26434590, 33118318
Minicore Myopathy with External Ophthalmoplegia	Associate	25328121
Multiple Myeloma	Associate	15459016
Myeloproliferative Syndrome Transient	Associate	22296450
Nasopharyngeal Carcinoma	Associate	18833293, 21305000, 21605886
Neoplasm Metastasis	Associate	37518985
Neoplasms	Associate	10576656, 11511788, 1372989, 15184504, 16873055, 18689862, 21205865, 21233309, 23260199, 25032863, 28332630, 29335436, 30927552, 31088931, 31171703 View all (11 more)
Neoplasms	Inhibit	10950866, 12080044, 14672938, 15273249, 15459016, 17030982, 18039859, 19217413, 20100838, 22010578, 22013060, 22213200, 22296450, 22589541, 22615843 View all (17 more)
Neuroblastoma	Associate	17986232, 31698611
Neurodegenerative Diseases	Associate	10233977
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	33560392
Osteitis Deformans	Associate	21623375
Osteoporosis	Associate	36937804
Osteosarcoma	Associate	26429972
Pancreatic Neoplasms	Associate	31557059
Penile Neoplasms	Associate	28751665
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11552979, 17897302, 9609531
Preeclamptic toxemia	Associate	20228380
Progeria	Associate	32351002
Prostatic Hyperplasia	Associate	21205865
Prostatic Neoplasms	Associate	21205865, 23492774, 26549027, 29335436
Prostatic Neoplasms	Inhibit	30279207
Prostatitis	Associate	28332630
Pulmonary Disease Chronic Obstructive	Associate	22829758
Radiation Injuries	Associate	34570619
Recurrence	Associate	9680345
Sarcoma Kaposi	Associate	24453968
Severe Acute Respiratory Syndrome	Associate	33560392, 37261339
Small Cell Lung Carcinoma	Associate	34741430
Spinocerebellar Ataxias	Associate	31710088
Squamous Cell Carcinoma of Head and Neck	Associate	19597475, 37542347
Stomach Neoplasms	Associate	19154407, 22013060, 25921172
Stomach Neoplasms	Inhibit	26163631
Triple Negative Breast Neoplasms	Associate	37823593, 40595914
Virus Diseases	Associate	18039859, 19523662, 29107745
Warts	Associate	12477870

PML (PML nuclear body scaffold)