Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs
Entrez ID	11040
Gene name	Pim-2 proto-oncogene, serine/threonine kinase
Gene symbol	PIM2
Synonyms (NCBI Gene)	-
Chromosome	X
Chromosome location	Xp11.23
Summary	This gene encodes a protooncogene that acts as a serine/threonine protein kinase. Studies determined the encoded protein functions to prevent apoptosis and to promote cell survival.[provided by RefSeq, Nov 2009]

145

Show/Hide all (145)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030307	hsa-miR-26b-5p	Microarray	19088304
MIRT030617	hsa-miR-24-3p	Sequencing	20371350
MIRT036440	hsa-miR-1226-3p	CLASH	23622248
MIRT471073	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT471072	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT471071	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT471070	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT471069	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT471068	hsa-miR-940	PAR-CLIP	23592263
MIRT471067	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT471065	hsa-miR-4514	PAR-CLIP	23592263
MIRT471066	hsa-miR-4692	PAR-CLIP	23592263
MIRT471064	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT471063	hsa-miR-4673	PAR-CLIP	23592263
MIRT471062	hsa-miR-1253	PAR-CLIP	23592263
MIRT471061	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT471060	hsa-miR-8064	PAR-CLIP	23592263
MIRT471059	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT471058	hsa-miR-4434	PAR-CLIP	23592263
MIRT471056	hsa-miR-4516	PAR-CLIP	23592263
MIRT471057	hsa-miR-5703	PAR-CLIP	23592263
MIRT471073	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT471072	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT471071	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT471070	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT471069	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT471068	hsa-miR-940	PAR-CLIP	23592263
MIRT471067	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT471065	hsa-miR-4514	PAR-CLIP	23592263
MIRT471066	hsa-miR-4692	PAR-CLIP	23592263
MIRT471064	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT471063	hsa-miR-4673	PAR-CLIP	23592263
MIRT471062	hsa-miR-1253	PAR-CLIP	23592263
MIRT471061	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT471060	hsa-miR-8064	PAR-CLIP	23592263
MIRT471059	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT471058	hsa-miR-4434	PAR-CLIP	23592263
MIRT471056	hsa-miR-4516	PAR-CLIP	23592263
MIRT471057	hsa-miR-5703	PAR-CLIP	23592263
MIRT1235168	hsa-miR-1182	CLIP-seq
MIRT1235169	hsa-miR-1226	CLIP-seq
MIRT1235170	hsa-miR-1243	CLIP-seq
MIRT1235171	hsa-miR-1292	CLIP-seq
MIRT1235172	hsa-miR-188-5p	CLIP-seq
MIRT1235173	hsa-miR-197	CLIP-seq
MIRT1235174	hsa-miR-200b	CLIP-seq
MIRT1235175	hsa-miR-200c	CLIP-seq
MIRT1235176	hsa-miR-2276	CLIP-seq
MIRT1235177	hsa-miR-24	CLIP-seq
MIRT1235178	hsa-miR-3614-5p	CLIP-seq
MIRT1235179	hsa-miR-3654	CLIP-seq
MIRT1235180	hsa-miR-3664-3p	CLIP-seq
MIRT1235181	hsa-miR-378	CLIP-seq
MIRT1235182	hsa-miR-378b	CLIP-seq
MIRT1235183	hsa-miR-378c	CLIP-seq
MIRT1235184	hsa-miR-378d	CLIP-seq
MIRT1235185	hsa-miR-378e	CLIP-seq
MIRT1235186	hsa-miR-378f	CLIP-seq
MIRT1235187	hsa-miR-378h	CLIP-seq
MIRT1235188	hsa-miR-378i	CLIP-seq
MIRT1235189	hsa-miR-412	CLIP-seq
MIRT1235190	hsa-miR-422a	CLIP-seq
MIRT1235191	hsa-miR-4283	CLIP-seq
MIRT1235192	hsa-miR-429	CLIP-seq
MIRT1235193	hsa-miR-4433	CLIP-seq
MIRT1235194	hsa-miR-4437	CLIP-seq
MIRT1235195	hsa-miR-4449	CLIP-seq
MIRT1235196	hsa-miR-4459	CLIP-seq
MIRT1235197	hsa-miR-4471	CLIP-seq
MIRT1235198	hsa-miR-4490	CLIP-seq
MIRT1235199	hsa-miR-4508	CLIP-seq
MIRT1235200	hsa-miR-450b-3p	CLIP-seq
MIRT1235201	hsa-miR-4520a-3p	CLIP-seq
MIRT1235202	hsa-miR-4520b-3p	CLIP-seq
MIRT1235203	hsa-miR-4532	CLIP-seq
MIRT1235204	hsa-miR-4684-3p	CLIP-seq
MIRT1235205	hsa-miR-4696	CLIP-seq
MIRT1235206	hsa-miR-4724-3p	CLIP-seq
MIRT1235207	hsa-miR-4733-3p	CLIP-seq
MIRT1235208	hsa-miR-4772-3p	CLIP-seq
MIRT1235209	hsa-miR-4797-5p	CLIP-seq
MIRT1235210	hsa-miR-765	CLIP-seq
MIRT1235211	hsa-miR-769-3p	CLIP-seq
MIRT2069234	hsa-miR-3065-5p	CLIP-seq
MIRT2069235	hsa-miR-3121-5p	CLIP-seq
MIRT2069236	hsa-miR-3159	CLIP-seq
MIRT2069237	hsa-miR-3192	CLIP-seq
MIRT2069238	hsa-miR-3674	CLIP-seq
MIRT2069239	hsa-miR-3689a-3p	CLIP-seq
MIRT2069240	hsa-miR-3689c	CLIP-seq
MIRT2069241	hsa-miR-4314	CLIP-seq
MIRT2069242	hsa-miR-4448	CLIP-seq
MIRT2069243	hsa-miR-4476	CLIP-seq
MIRT2069244	hsa-miR-4646-5p	CLIP-seq
MIRT2069245	hsa-miR-4728-5p	CLIP-seq
MIRT2069246	hsa-miR-505	CLIP-seq
MIRT2069247	hsa-miR-654-3p	CLIP-seq
MIRT1235170	hsa-miR-1243	CLIP-seq
MIRT1235171	hsa-miR-1292	CLIP-seq
MIRT2296314	hsa-miR-1343	CLIP-seq
MIRT2296315	hsa-miR-140-3p	CLIP-seq
MIRT2296316	hsa-miR-1587	CLIP-seq
MIRT2296317	hsa-miR-1827	CLIP-seq
MIRT1235172	hsa-miR-188-5p	CLIP-seq
MIRT1235173	hsa-miR-197	CLIP-seq
MIRT1235174	hsa-miR-200b	CLIP-seq
MIRT1235175	hsa-miR-200c	CLIP-seq
MIRT1235177	hsa-miR-24	CLIP-seq
MIRT2069235	hsa-miR-3121-5p	CLIP-seq
MIRT2069236	hsa-miR-3159	CLIP-seq
MIRT2069237	hsa-miR-3192	CLIP-seq
MIRT1235178	hsa-miR-3614-5p	CLIP-seq
MIRT1235179	hsa-miR-3654	CLIP-seq
MIRT2069238	hsa-miR-3674	CLIP-seq
MIRT2069239	hsa-miR-3689a-3p	CLIP-seq
MIRT2069240	hsa-miR-3689c	CLIP-seq
MIRT1235181	hsa-miR-378	CLIP-seq
MIRT1235182	hsa-miR-378b	CLIP-seq
MIRT1235183	hsa-miR-378c	CLIP-seq
MIRT1235184	hsa-miR-378d	CLIP-seq
MIRT1235185	hsa-miR-378e	CLIP-seq
MIRT1235186	hsa-miR-378f	CLIP-seq
MIRT2296318	hsa-miR-378g	CLIP-seq
MIRT1235187	hsa-miR-378h	CLIP-seq
MIRT1235188	hsa-miR-378i	CLIP-seq
MIRT1235189	hsa-miR-412	CLIP-seq
MIRT1235190	hsa-miR-422a	CLIP-seq
MIRT1235192	hsa-miR-429	CLIP-seq
MIRT2069241	hsa-miR-4314	CLIP-seq
MIRT2069242	hsa-miR-4448	CLIP-seq
MIRT1235197	hsa-miR-4471	CLIP-seq
MIRT2069243	hsa-miR-4476	CLIP-seq
MIRT1235198	hsa-miR-4490	CLIP-seq
MIRT2296319	hsa-miR-4492	CLIP-seq
MIRT2296320	hsa-miR-4498	CLIP-seq
MIRT2069244	hsa-miR-4646-5p	CLIP-seq
MIRT2296321	hsa-miR-4649-3p	CLIP-seq
MIRT2296322	hsa-miR-4656	CLIP-seq
MIRT2296323	hsa-miR-4675	CLIP-seq
MIRT1235206	hsa-miR-4724-3p	CLIP-seq
MIRT2069245	hsa-miR-4728-5p	CLIP-seq
MIRT2296324	hsa-miR-4736	CLIP-seq
MIRT2296325	hsa-miR-4741	CLIP-seq
MIRT2296326	hsa-miR-646	CLIP-seq
MIRT2296327	hsa-miR-762	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	20307683
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18593906
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16713569, 25416956, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0006468	Process	Protein phosphorylation	IDA	18593906
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	20307683
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0009615	Process	Response to virus	IEP	16548883
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	ISS
GO:0016236	Process	Macroautophagy	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18675992
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	IMP	20307683
GO:0050821	Process	Protein stabilization	ISS
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
300295	8987	ENSG00000102096

Q9P1W9

Protein name

Serine/threonine-protein kinase pim-2 (EC 2.7.11.1) (Pim-2h)

Protein function

Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression, the regulatio

PDB

2IWI , 4X7Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	32 → 286	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in hematopoietic tissues, in leukemic and lymphoma cell lines, testis, small intestine, colon and colorectal adenocarcinoma cells. Weakly expressed in normal liver, but highly expressed in hepatocellular carcinoma tiss

Sequence

MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP

Sequence length

311

Interactions

View interactions

PIM2 (Pim-2 proto-oncogene, serine/threonine kinase)