Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs
Entrez ID	5292
Gene name	Pim-1 proto-oncogene, serine/threonine kinase
Gene symbol	PIM1
Synonyms (NCBI Gene)	PIM
Chromosome	6
Chromosome location	6p21.2
Summary	The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a

286

Show/Hide all (286)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004322	hsa-miR-1-3p	qRT-PCRLuciferase reporter assayWestern blot	18818206
MIRT000151	hsa-miR-210-3p	Luciferase reporter assay	19782034
MIRT004857	hsa-miR-192-5p	Luciferase reporter assayqRT-PCR	19074876
MIRT004322	hsa-miR-1-3p	Luciferase reporter assayNorthern blotWestern blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assayNorthern blotWestern blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assayNorthern blotWestern blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assayNorthern blotWestern blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assayNorthern blotWestern blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assayNorthern blotWestern blot	21051663
MIRT006870	hsa-miR-16-5p	Luciferase reporter assay	22970245
MIRT017680	hsa-miR-335-5p	Microarray	18185580
MIRT024423	hsa-miR-215-5p	Microarray	19074876
MIRT004857	hsa-miR-192-5p	Sequencing	20371350
MIRT004857	hsa-miR-192-5p	Reporter assay;Microarray;Other	19074876
MIRT028248	hsa-miR-33a-5p	Reporter assay	21743487
MIRT054035	hsa-miR-33b-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22983447
MIRT100569	hsa-miR-214-3p	MicroarrayqRT-PCR	22815788
MIRT218896	hsa-miR-486-5p	qRT-PCR	23294929
MIRT218896	hsa-miR-486-5p	qRT-PCR	23294929
MIRT700789	hsa-miR-651-3p	HITS-CLIP	23313552
MIRT700788	hsa-miR-4496	HITS-CLIP	23313552
MIRT700787	hsa-miR-1272	HITS-CLIP	23313552
MIRT700786	hsa-miR-584-3p	HITS-CLIP	23313552
MIRT700785	hsa-miR-1252-5p	HITS-CLIP	23313552
MIRT700784	hsa-miR-4261	HITS-CLIP	23313552
MIRT700783	hsa-miR-1207-5p	HITS-CLIP	23313552
MIRT700782	hsa-miR-4763-3p	HITS-CLIP	23313552
MIRT700781	hsa-miR-4736	HITS-CLIP	23313552
MIRT700780	hsa-miR-5581-3p	HITS-CLIP	23313552
MIRT700779	hsa-miR-7150	HITS-CLIP	23313552
MIRT100571	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT100566	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100570	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT006870	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT100572	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT100573	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT100585	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100574	hsa-miR-583	PAR-CLIP	23446348
MIRT100569	hsa-miR-214-3p	PAR-CLIP	23446348
MIRT100576	hsa-miR-3619-5p	PAR-CLIP	23446348
MIRT100575	hsa-miR-761	PAR-CLIP	23446348
MIRT100577	hsa-miR-4434	PAR-CLIP	23446348
MIRT100578	hsa-miR-4516	PAR-CLIP	23446348
MIRT100581	hsa-miR-5703	PAR-CLIP	23446348
MIRT100579	hsa-miR-4531	PAR-CLIP	23446348
MIRT513759	hsa-miR-1270	PAR-CLIP	23446348
MIRT513758	hsa-miR-620	PAR-CLIP	23446348
MIRT513757	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT513756	hsa-miR-1246	PAR-CLIP	23446348
MIRT168865	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT168866	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT004322	hsa-miR-1-3p	Western blot	26820394
MIRT100569	hsa-miR-214-3p	Western blot	26820394
MIRT168868	hsa-miR-124-3p	Luciferase reporter assay	27088547
MIRT168868	hsa-miR-124-3p	Luciferase reporter assay	27088547
MIRT168877	hsa-miR-542-3p	Luciferase reporter assay	27107696
MIRT168877	hsa-miR-542-3p	Luciferase reporter assay	27107696
MIRT218892	hsa-miR-101-3p	Luciferase reporter assayWestern blot	26693056
MIRT218892	hsa-miR-101-3p	Luciferase reporter assayWestern blot	26693056
MIRT218896	hsa-miR-486-5p	Western blotting	33955505
MIRT736935	hsa-miR-486-3p	Western blottingMicroarray	33955505
MIRT700789	hsa-miR-651-3p	HITS-CLIP	23313552
MIRT700788	hsa-miR-4496	HITS-CLIP	23313552
MIRT700787	hsa-miR-1272	HITS-CLIP	23313552
MIRT700786	hsa-miR-584-3p	HITS-CLIP	23313552
MIRT700785	hsa-miR-1252-5p	HITS-CLIP	23313552
MIRT700784	hsa-miR-4261	HITS-CLIP	23313552
MIRT700783	hsa-miR-1207-5p	HITS-CLIP	23313552
MIRT700782	hsa-miR-4763-3p	HITS-CLIP	23313552
MIRT700781	hsa-miR-4736	HITS-CLIP	23313552
MIRT700780	hsa-miR-5581-3p	HITS-CLIP	23313552
MIRT700779	hsa-miR-7150	HITS-CLIP	23313552
MIRT100571	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT100566	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100570	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT006870	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT100572	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT100573	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT100585	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100574	hsa-miR-583	PAR-CLIP	23446348
MIRT100569	hsa-miR-214-3p	PAR-CLIP	23446348
MIRT100576	hsa-miR-3619-5p	PAR-CLIP	23446348
MIRT100575	hsa-miR-761	PAR-CLIP	23446348
MIRT100577	hsa-miR-4434	PAR-CLIP	23446348
MIRT100578	hsa-miR-4516	PAR-CLIP	23446348
MIRT100581	hsa-miR-5703	PAR-CLIP	23446348
MIRT100579	hsa-miR-4531	PAR-CLIP	23446348
MIRT513759	hsa-miR-1270	PAR-CLIP	23446348
MIRT513758	hsa-miR-620	PAR-CLIP	23446348
MIRT513757	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT513756	hsa-miR-1246	PAR-CLIP	23446348
MIRT218896	hsa-miR-486-5p	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	34519263
MIRT1235101	hsa-miR-124	CLIP-seq
MIRT1235102	hsa-miR-1252	CLIP-seq
MIRT1235103	hsa-miR-1267	CLIP-seq
MIRT1235104	hsa-miR-1289	CLIP-seq
MIRT1235105	hsa-miR-1294	CLIP-seq
MIRT1235106	hsa-miR-129-5p	CLIP-seq
MIRT1235107	hsa-miR-1297	CLIP-seq
MIRT1235108	hsa-miR-1299	CLIP-seq
MIRT1235109	hsa-miR-1321	CLIP-seq
MIRT1235110	hsa-miR-1323	CLIP-seq
MIRT1235111	hsa-miR-147	CLIP-seq
MIRT1235112	hsa-miR-150	CLIP-seq
MIRT1235113	hsa-miR-2113	CLIP-seq
MIRT1235114	hsa-miR-214	CLIP-seq
MIRT1235115	hsa-miR-26a	CLIP-seq
MIRT1235116	hsa-miR-26b	CLIP-seq
MIRT1235117	hsa-miR-3126-5p	CLIP-seq
MIRT1235118	hsa-miR-3140-3p	CLIP-seq
MIRT1235119	hsa-miR-3173-3p	CLIP-seq
MIRT1235120	hsa-miR-3202	CLIP-seq
MIRT1235121	hsa-miR-329	CLIP-seq
MIRT1235122	hsa-miR-33a	CLIP-seq
MIRT1235123	hsa-miR-33b	CLIP-seq
MIRT1235124	hsa-miR-362-3p	CLIP-seq
MIRT1235125	hsa-miR-3662	CLIP-seq
MIRT1235126	hsa-miR-3673	CLIP-seq
MIRT1235127	hsa-miR-3688-3p	CLIP-seq
MIRT1235128	hsa-miR-370	CLIP-seq
MIRT1235129	hsa-miR-371b-5p	CLIP-seq
MIRT1235130	hsa-miR-3907	CLIP-seq
MIRT1235131	hsa-miR-3941	CLIP-seq
MIRT1235132	hsa-miR-4286	CLIP-seq
MIRT1235133	hsa-miR-4316	CLIP-seq
MIRT1235134	hsa-miR-4323	CLIP-seq
MIRT1235135	hsa-miR-4419a	CLIP-seq
MIRT1235136	hsa-miR-4436b-3p	CLIP-seq
MIRT1235137	hsa-miR-4453	CLIP-seq
MIRT1235138	hsa-miR-4465	CLIP-seq
MIRT1235139	hsa-miR-4510	CLIP-seq
MIRT1235140	hsa-miR-4530	CLIP-seq
MIRT1235141	hsa-miR-4533	CLIP-seq
MIRT1235142	hsa-miR-4538	CLIP-seq
MIRT1235143	hsa-miR-4540	CLIP-seq
MIRT1235144	hsa-miR-4652-3p	CLIP-seq
MIRT1235145	hsa-miR-4690-5p	CLIP-seq
MIRT1235146	hsa-miR-4710	CLIP-seq
MIRT1235147	hsa-miR-4713-5p	CLIP-seq
MIRT1235148	hsa-miR-4733-5p	CLIP-seq
MIRT1235149	hsa-miR-4739	CLIP-seq
MIRT1235150	hsa-miR-4756-5p	CLIP-seq
MIRT1235151	hsa-miR-4761-3p	CLIP-seq
MIRT1235152	hsa-miR-4779	CLIP-seq
MIRT1235153	hsa-miR-4785	CLIP-seq
MIRT1235154	hsa-miR-506	CLIP-seq
MIRT1235155	hsa-miR-522	CLIP-seq
MIRT1235156	hsa-miR-532-3p	CLIP-seq
MIRT1235157	hsa-miR-548aa	CLIP-seq
MIRT1235158	hsa-miR-548o	CLIP-seq
MIRT1235159	hsa-miR-554	CLIP-seq
MIRT1235160	hsa-miR-599	CLIP-seq
MIRT1235161	hsa-miR-603	CLIP-seq
MIRT1235162	hsa-miR-634	CLIP-seq
MIRT1235163	hsa-miR-646	CLIP-seq
MIRT1235164	hsa-miR-671-5p	CLIP-seq
MIRT1235165	hsa-miR-767-3p	CLIP-seq
MIRT1235166	hsa-miR-875-3p	CLIP-seq
MIRT1235167	hsa-miR-944	CLIP-seq
MIRT1235101	hsa-miR-124	CLIP-seq
MIRT1235103	hsa-miR-1267	CLIP-seq
MIRT1235104	hsa-miR-1289	CLIP-seq
MIRT1235107	hsa-miR-1297	CLIP-seq
MIRT1235112	hsa-miR-150	CLIP-seq
MIRT2069224	hsa-miR-1827	CLIP-seq
MIRT1235115	hsa-miR-26a	CLIP-seq
MIRT1235116	hsa-miR-26b	CLIP-seq
MIRT2069225	hsa-miR-3135b	CLIP-seq
MIRT2069226	hsa-miR-3149	CLIP-seq
MIRT1235119	hsa-miR-3173-3p	CLIP-seq
MIRT2069227	hsa-miR-320e	CLIP-seq
MIRT1235121	hsa-miR-329	CLIP-seq
MIRT2069228	hsa-miR-3612	CLIP-seq
MIRT1235124	hsa-miR-362-3p	CLIP-seq
MIRT1235131	hsa-miR-3941	CLIP-seq
MIRT1235132	hsa-miR-4286	CLIP-seq
MIRT1235138	hsa-miR-4465	CLIP-seq
MIRT2069229	hsa-miR-4509	CLIP-seq
MIRT1235144	hsa-miR-4652-3p	CLIP-seq
MIRT2069230	hsa-miR-4695-5p	CLIP-seq
MIRT1235147	hsa-miR-4713-5p	CLIP-seq
MIRT1235154	hsa-miR-506	CLIP-seq
MIRT1235156	hsa-miR-532-3p	CLIP-seq
MIRT2069231	hsa-miR-568	CLIP-seq
MIRT1235161	hsa-miR-603	CLIP-seq
MIRT2069232	hsa-miR-650	CLIP-seq
MIRT2069233	hsa-miR-668	CLIP-seq
MIRT1235101	hsa-miR-124	CLIP-seq
MIRT1235106	hsa-miR-129-5p	CLIP-seq
MIRT1235113	hsa-miR-2113	CLIP-seq
MIRT1235132	hsa-miR-4286	CLIP-seq
MIRT1235154	hsa-miR-506	CLIP-seq
MIRT2296313	hsa-miR-711	CLIP-seq
MIRT1235113	hsa-miR-2113	CLIP-seq
MIRT1235121	hsa-miR-329	CLIP-seq
MIRT1235124	hsa-miR-362-3p	CLIP-seq
MIRT1235131	hsa-miR-3941	CLIP-seq
MIRT1235144	hsa-miR-4652-3p	CLIP-seq
MIRT1235161	hsa-miR-603	CLIP-seq
MIRT2439499	hsa-miR-1247	CLIP-seq
MIRT2439500	hsa-miR-4258	CLIP-seq
MIRT2439501	hsa-miR-4449	CLIP-seq
MIRT2439499	hsa-miR-1247	CLIP-seq
MIRT1235102	hsa-miR-1252	CLIP-seq
MIRT1235109	hsa-miR-1321	CLIP-seq
MIRT2594037	hsa-miR-185	CLIP-seq
MIRT2594038	hsa-miR-208a	CLIP-seq
MIRT2594039	hsa-miR-208b	CLIP-seq
MIRT1235117	hsa-miR-3126-5p	CLIP-seq
MIRT1235119	hsa-miR-3173-3p	CLIP-seq
MIRT1235120	hsa-miR-3202	CLIP-seq
MIRT2594040	hsa-miR-361-3p	CLIP-seq
MIRT2594041	hsa-miR-3617	CLIP-seq
MIRT1235126	hsa-miR-3673	CLIP-seq
MIRT1235127	hsa-miR-3688-3p	CLIP-seq
MIRT2594042	hsa-miR-3691-3p	CLIP-seq
MIRT2594043	hsa-miR-4257	CLIP-seq
MIRT2439500	hsa-miR-4258	CLIP-seq
MIRT2594044	hsa-miR-4272	CLIP-seq
MIRT2594045	hsa-miR-4290	CLIP-seq
MIRT2594046	hsa-miR-4306	CLIP-seq
MIRT1235135	hsa-miR-4419a	CLIP-seq
MIRT1235136	hsa-miR-4436b-3p	CLIP-seq
MIRT2439501	hsa-miR-4449	CLIP-seq
MIRT1235137	hsa-miR-4453	CLIP-seq
MIRT2594047	hsa-miR-4476	CLIP-seq
MIRT1235139	hsa-miR-4510	CLIP-seq
MIRT1235142	hsa-miR-4538	CLIP-seq
MIRT2594048	hsa-miR-4644	CLIP-seq
MIRT2594049	hsa-miR-4687-5p	CLIP-seq
MIRT1235146	hsa-miR-4710	CLIP-seq
MIRT1235149	hsa-miR-4739	CLIP-seq
MIRT1235150	hsa-miR-4756-5p	CLIP-seq
MIRT1235151	hsa-miR-4761-3p	CLIP-seq
MIRT2594050	hsa-miR-4768-3p	CLIP-seq
MIRT1235152	hsa-miR-4779	CLIP-seq
MIRT2594051	hsa-miR-499-5p	CLIP-seq
MIRT2594052	hsa-miR-641	CLIP-seq
MIRT1235163	hsa-miR-646	CLIP-seq
MIRT1235164	hsa-miR-671-5p	CLIP-seq
MIRT2439499	hsa-miR-1247	CLIP-seq
MIRT1235102	hsa-miR-1252	CLIP-seq
MIRT1235109	hsa-miR-1321	CLIP-seq
MIRT2687924	hsa-miR-15a	CLIP-seq
MIRT2687925	hsa-miR-15b	CLIP-seq
MIRT2687926	hsa-miR-16	CLIP-seq
MIRT2594037	hsa-miR-185	CLIP-seq
MIRT2687927	hsa-miR-195	CLIP-seq
MIRT2594038	hsa-miR-208a	CLIP-seq
MIRT2594039	hsa-miR-208b	CLIP-seq
MIRT1235114	hsa-miR-214	CLIP-seq
MIRT1235117	hsa-miR-3126-5p	CLIP-seq
MIRT1235119	hsa-miR-3173-3p	CLIP-seq
MIRT2594040	hsa-miR-361-3p	CLIP-seq
MIRT2594041	hsa-miR-3617	CLIP-seq
MIRT1235127	hsa-miR-3688-3p	CLIP-seq
MIRT2594042	hsa-miR-3691-3p	CLIP-seq
MIRT2687928	hsa-miR-424	CLIP-seq
MIRT2594043	hsa-miR-4257	CLIP-seq
MIRT2439500	hsa-miR-4258	CLIP-seq
MIRT2594044	hsa-miR-4272	CLIP-seq
MIRT2594045	hsa-miR-4290	CLIP-seq
MIRT2594046	hsa-miR-4306	CLIP-seq
MIRT1235135	hsa-miR-4419a	CLIP-seq
MIRT1235136	hsa-miR-4436b-3p	CLIP-seq
MIRT2439501	hsa-miR-4449	CLIP-seq
MIRT1235137	hsa-miR-4453	CLIP-seq
MIRT1235139	hsa-miR-4510	CLIP-seq
MIRT2687929	hsa-miR-4514	CLIP-seq
MIRT1235142	hsa-miR-4538	CLIP-seq
MIRT2594048	hsa-miR-4644	CLIP-seq
MIRT2687930	hsa-miR-4645-5p	CLIP-seq
MIRT2687931	hsa-miR-4673	CLIP-seq
MIRT2594049	hsa-miR-4687-5p	CLIP-seq
MIRT2687932	hsa-miR-4692	CLIP-seq
MIRT1235146	hsa-miR-4710	CLIP-seq
MIRT1235149	hsa-miR-4739	CLIP-seq
MIRT1235150	hsa-miR-4756-5p	CLIP-seq
MIRT1235151	hsa-miR-4761-3p	CLIP-seq
MIRT2594050	hsa-miR-4768-3p	CLIP-seq
MIRT1235152	hsa-miR-4779	CLIP-seq
MIRT2687933	hsa-miR-497	CLIP-seq
MIRT2594051	hsa-miR-499-5p	CLIP-seq
MIRT2594052	hsa-miR-641	CLIP-seq
MIRT1235163	hsa-miR-646	CLIP-seq
MIRT1235164	hsa-miR-671-5p	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
ABL1	Activation	15145216
ERG	Activation	22140532
STAT1	Unknown	10068671
STAT3	Activation	22273698
STAT3	Unknown	10068671
STAT4	Unknown	10068671

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	1825810, 18056989, 18593906, 31548394, 37797010
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16186805, 16266891, 18056989, 18593906, 25096571, 25416956, 30017192
GO:0005524	Function	ATP binding	IDA	1825810
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	16186805, 21474815
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	1825810, 21474815
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	16186805
GO:0005886	Component	Plasma membrane	IDA	16186805
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	1825810, 16266891, 18056989, 18593906
GO:0006915	Process	Apoptotic process	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0008134	Function	Transcription factor binding	IPI	18593906
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0022898	Process	Regulation of transmembrane transporter activity	IMP	18056989
GO:0030145	Function	Manganese ion binding	IDA	1825810
GO:0030145	Function	Manganese ion binding	IEA
GO:0031669	Process	Cellular response to nutrient levels	IDA	31601708
GO:0034198	Process	Cellular response to amino acid starvation	IDA	35338845
GO:0042742	Process	Defense response to bacterium	IDA	31268602
GO:0043024	Function	Ribosomal small subunit binding	IPI	16266891
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	16186805
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	18593906
GO:0043539	Function	Protein serine/threonine kinase activator activity	IMP	16186805
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	18593906
GO:0045824	Process	Negative regulation of innate immune response	IDA	37797010
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	16266891
GO:0046777	Process	Protein autophosphorylation	IMP	18593906
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0051715	Process	Cytolysis in another organism	IDA	31268602
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IDA	21474815
GO:0070561	Process	Vitamin D receptor signaling pathway	IMP	22720752
GO:0071346	Process	Cellular response to type II interferon	IDA	37797010
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IMP	16186805
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	31268602
GO:1902033	Process	Regulation of hematopoietic stem cell proliferation	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	35338845
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	31601708
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	31548394
GO:1905062	Process	Positive regulation of cardioblast proliferation	IDA	21474815
GO:1990748	Process	Cellular detoxification	IMP	18056989

MIM	HGNC	e!Ensembl
164960	8986	ENSG00000137193

P11309

Protein name

Serine/threonine-protein kinase pim-1 (EC 2.7.11.1)

Protein function

Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation and thus providing a selective advantage in tumorigenesis (PubMed:15528381, PubMed:1825810, PubMed:31548394). Exerts its oncogenic activity thr

PDB

1XQZ , 1XR1 , 1XWS , 1YHS , 1YI3 , 1YI4 , 1YWV , 1YXS , 1YXT , 1YXU , 1YXV , 1YXX , 2BIK , 2BIL , 2BZH , 2BZI , 2BZJ , 2BZK , 2C3I , 2J2I , 2O3P , 2O63 , 2O64 , 2O65 , 2OBJ , 2OI4 , 2XIX , 2XIY , 2XIZ , 2XJ0 , 2XJ1 , 2XJ2 , 3A99 , 3BGP , 3BGQ , 3BGZ , 3BWF , 3C4E , 3CXW , 3CY2 , 3CY3 , 3DCV , 3F2A , 3JPV , 3JXW , 3JY0 , 3JYA , 3MA3 , 3QF9 , 3R00 , 3R01

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	38 → 290	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed primarily in cells of the hematopoietic and germline lineages. Isoform 1 and isoform 2 are both expressed in prostate cancer cell lines. {ECO:0000269|PubMed:16186805}.

Sequence

MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK

Sequence length

313

Interactions

View interactions

PIM1 (Pim-1 proto-oncogene, serine/threonine kinase)