Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5292
Gene name Gene Name - the full gene name approved by the HGNC.	Pim-1 proto-oncogene, serine/threonine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PIM1
Synonyms (NCBI Gene) Gene synonyms aliases	PIM
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a

Show/Hide all(286)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004322	hsa-miR-1-3p	qRT-PCR, Luciferase reporter assay, Western blot	18818206
MIRT000151	hsa-miR-210-3p	Luciferase reporter assay	19782034
MIRT004857	hsa-miR-192-5p	Luciferase reporter assay, qRT-PCR	19074876
MIRT004322	hsa-miR-1-3p	Luciferase reporter assay, Northern blot, Western blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assay, Northern blot, Western blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assay, Northern blot, Western blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assay, Northern blot, Western blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assay, Northern blot, Western blot	21051663
MIRT004322	hsa-miR-1-3p	Luciferase reporter assay, Northern blot, Western blot	21051663
MIRT006870	hsa-miR-16-5p	Luciferase reporter assay	22970245
MIRT017680	hsa-miR-335-5p	Microarray	18185580
MIRT024423	hsa-miR-215-5p	Microarray	19074876
MIRT004857	hsa-miR-192-5p	Sequencing	20371350
MIRT004857	hsa-miR-192-5p	Reporter assay;Microarray;Other	19074876
MIRT028248	hsa-miR-33a-5p	Reporter assay	21743487
MIRT054035	hsa-miR-33b-5p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22983447
MIRT100569	hsa-miR-214-3p	Microarray, qRT-PCR	22815788
MIRT218896	hsa-miR-486-5p	qRT-PCR	23294929
MIRT218896	hsa-miR-486-5p	qRT-PCR	23294929
MIRT700789	hsa-miR-651-3p	HITS-CLIP	23313552
MIRT700788	hsa-miR-4496	HITS-CLIP	23313552
MIRT700787	hsa-miR-1272	HITS-CLIP	23313552
MIRT700786	hsa-miR-584-3p	HITS-CLIP	23313552
MIRT700785	hsa-miR-1252-5p	HITS-CLIP	23313552
MIRT700784	hsa-miR-4261	HITS-CLIP	23313552
MIRT700783	hsa-miR-1207-5p	HITS-CLIP	23313552
MIRT700782	hsa-miR-4763-3p	HITS-CLIP	23313552
MIRT700781	hsa-miR-4736	HITS-CLIP	23313552
MIRT700780	hsa-miR-5581-3p	HITS-CLIP	23313552
MIRT700779	hsa-miR-7150	HITS-CLIP	23313552
MIRT100571	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT100566	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100570	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT006870	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT100572	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT100573	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT100585	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100574	hsa-miR-583	PAR-CLIP	23446348
MIRT100569	hsa-miR-214-3p	PAR-CLIP	23446348
MIRT100576	hsa-miR-3619-5p	PAR-CLIP	23446348
MIRT100575	hsa-miR-761	PAR-CLIP	23446348
MIRT100577	hsa-miR-4434	PAR-CLIP	23446348
MIRT100578	hsa-miR-4516	PAR-CLIP	23446348
MIRT100581	hsa-miR-5703	PAR-CLIP	23446348
MIRT100579	hsa-miR-4531	PAR-CLIP	23446348
MIRT513759	hsa-miR-1270	PAR-CLIP	23446348
MIRT513758	hsa-miR-620	PAR-CLIP	23446348
MIRT513757	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT513756	hsa-miR-1246	PAR-CLIP	23446348
MIRT168865	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT168866	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT004322	hsa-miR-1-3p	Western blot	26820394
MIRT100569	hsa-miR-214-3p	Western blot	26820394
MIRT168868	hsa-miR-124-3p	Luciferase reporter assay	27088547
MIRT168868	hsa-miR-124-3p	Luciferase reporter assay	27088547
MIRT168877	hsa-miR-542-3p	Luciferase reporter assay	27107696
MIRT168877	hsa-miR-542-3p	Luciferase reporter assay	27107696
MIRT218892	hsa-miR-101-3p	Luciferase reporter assay, Western blot	26693056
MIRT218892	hsa-miR-101-3p	Luciferase reporter assay, Western blot	26693056
MIRT218896	hsa-miR-486-5p	Western blotting	33955505
MIRT736935	hsa-miR-486-3p	Western blotting, Microarray	33955505
MIRT700789	hsa-miR-651-3p	HITS-CLIP	23313552
MIRT700788	hsa-miR-4496	HITS-CLIP	23313552
MIRT700787	hsa-miR-1272	HITS-CLIP	23313552
MIRT700786	hsa-miR-584-3p	HITS-CLIP	23313552
MIRT700785	hsa-miR-1252-5p	HITS-CLIP	23313552
MIRT700784	hsa-miR-4261	HITS-CLIP	23313552
MIRT700783	hsa-miR-1207-5p	HITS-CLIP	23313552
MIRT700782	hsa-miR-4763-3p	HITS-CLIP	23313552
MIRT700781	hsa-miR-4736	HITS-CLIP	23313552
MIRT700780	hsa-miR-5581-3p	HITS-CLIP	23313552
MIRT700779	hsa-miR-7150	HITS-CLIP	23313552
MIRT100571	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT100566	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT100570	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT006870	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT100572	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT100573	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT100585	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT100574	hsa-miR-583	PAR-CLIP	23446348
MIRT100569	hsa-miR-214-3p	PAR-CLIP	23446348
MIRT100576	hsa-miR-3619-5p	PAR-CLIP	23446348
MIRT100575	hsa-miR-761	PAR-CLIP	23446348
MIRT100577	hsa-miR-4434	PAR-CLIP	23446348
MIRT100578	hsa-miR-4516	PAR-CLIP	23446348
MIRT100581	hsa-miR-5703	PAR-CLIP	23446348
MIRT100579	hsa-miR-4531	PAR-CLIP	23446348
MIRT513759	hsa-miR-1270	PAR-CLIP	23446348
MIRT513758	hsa-miR-620	PAR-CLIP	23446348
MIRT513757	hsa-miR-7850-5p	PAR-CLIP	23446348
MIRT513756	hsa-miR-1246	PAR-CLIP	23446348
MIRT218896	hsa-miR-486-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	34519263
MIRT1235101	hsa-miR-124	CLIP-seq
MIRT1235102	hsa-miR-1252	CLIP-seq
MIRT1235103	hsa-miR-1267	CLIP-seq
MIRT1235104	hsa-miR-1289	CLIP-seq
MIRT1235105	hsa-miR-1294	CLIP-seq
MIRT1235106	hsa-miR-129-5p	CLIP-seq
MIRT1235107	hsa-miR-1297	CLIP-seq
MIRT1235108	hsa-miR-1299	CLIP-seq
MIRT1235109	hsa-miR-1321	CLIP-seq
MIRT1235110	hsa-miR-1323	CLIP-seq
MIRT1235111	hsa-miR-147	CLIP-seq
MIRT1235112	hsa-miR-150	CLIP-seq
MIRT1235113	hsa-miR-2113	CLIP-seq
MIRT1235114	hsa-miR-214	CLIP-seq
MIRT1235115	hsa-miR-26a	CLIP-seq
MIRT1235116	hsa-miR-26b	CLIP-seq
MIRT1235117	hsa-miR-3126-5p	CLIP-seq
MIRT1235118	hsa-miR-3140-3p	CLIP-seq
MIRT1235119	hsa-miR-3173-3p	CLIP-seq
MIRT1235120	hsa-miR-3202	CLIP-seq
MIRT1235121	hsa-miR-329	CLIP-seq
MIRT1235122	hsa-miR-33a	CLIP-seq
MIRT1235123	hsa-miR-33b	CLIP-seq
MIRT1235124	hsa-miR-362-3p	CLIP-seq
MIRT1235125	hsa-miR-3662	CLIP-seq
MIRT1235126	hsa-miR-3673	CLIP-seq
MIRT1235127	hsa-miR-3688-3p	CLIP-seq
MIRT1235128	hsa-miR-370	CLIP-seq
MIRT1235129	hsa-miR-371b-5p	CLIP-seq
MIRT1235130	hsa-miR-3907	CLIP-seq
MIRT1235131	hsa-miR-3941	CLIP-seq
MIRT1235132	hsa-miR-4286	CLIP-seq
MIRT1235133	hsa-miR-4316	CLIP-seq
MIRT1235134	hsa-miR-4323	CLIP-seq
MIRT1235135	hsa-miR-4419a	CLIP-seq
MIRT1235136	hsa-miR-4436b-3p	CLIP-seq
MIRT1235137	hsa-miR-4453	CLIP-seq
MIRT1235138	hsa-miR-4465	CLIP-seq
MIRT1235139	hsa-miR-4510	CLIP-seq
MIRT1235140	hsa-miR-4530	CLIP-seq
MIRT1235141	hsa-miR-4533	CLIP-seq
MIRT1235142	hsa-miR-4538	CLIP-seq
MIRT1235143	hsa-miR-4540	CLIP-seq
MIRT1235144	hsa-miR-4652-3p	CLIP-seq
MIRT1235145	hsa-miR-4690-5p	CLIP-seq
MIRT1235146	hsa-miR-4710	CLIP-seq
MIRT1235147	hsa-miR-4713-5p	CLIP-seq
MIRT1235148	hsa-miR-4733-5p	CLIP-seq
MIRT1235149	hsa-miR-4739	CLIP-seq
MIRT1235150	hsa-miR-4756-5p	CLIP-seq
MIRT1235151	hsa-miR-4761-3p	CLIP-seq
MIRT1235152	hsa-miR-4779	CLIP-seq
MIRT1235153	hsa-miR-4785	CLIP-seq
MIRT1235154	hsa-miR-506	CLIP-seq
MIRT1235155	hsa-miR-522	CLIP-seq
MIRT1235156	hsa-miR-532-3p	CLIP-seq
MIRT1235157	hsa-miR-548aa	CLIP-seq
MIRT1235158	hsa-miR-548o	CLIP-seq
MIRT1235159	hsa-miR-554	CLIP-seq
MIRT1235160	hsa-miR-599	CLIP-seq
MIRT1235161	hsa-miR-603	CLIP-seq
MIRT1235162	hsa-miR-634	CLIP-seq
MIRT1235163	hsa-miR-646	CLIP-seq
MIRT1235164	hsa-miR-671-5p	CLIP-seq
MIRT1235165	hsa-miR-767-3p	CLIP-seq
MIRT1235166	hsa-miR-875-3p	CLIP-seq
MIRT1235167	hsa-miR-944	CLIP-seq
MIRT1235101	hsa-miR-124	CLIP-seq
MIRT1235103	hsa-miR-1267	CLIP-seq
MIRT1235104	hsa-miR-1289	CLIP-seq
MIRT1235107	hsa-miR-1297	CLIP-seq
MIRT1235112	hsa-miR-150	CLIP-seq
MIRT2069224	hsa-miR-1827	CLIP-seq
MIRT1235115	hsa-miR-26a	CLIP-seq
MIRT1235116	hsa-miR-26b	CLIP-seq
MIRT2069225	hsa-miR-3135b	CLIP-seq
MIRT2069226	hsa-miR-3149	CLIP-seq
MIRT1235119	hsa-miR-3173-3p	CLIP-seq
MIRT2069227	hsa-miR-320e	CLIP-seq
MIRT1235121	hsa-miR-329	CLIP-seq
MIRT2069228	hsa-miR-3612	CLIP-seq
MIRT1235124	hsa-miR-362-3p	CLIP-seq
MIRT1235131	hsa-miR-3941	CLIP-seq
MIRT1235132	hsa-miR-4286	CLIP-seq
MIRT1235138	hsa-miR-4465	CLIP-seq
MIRT2069229	hsa-miR-4509	CLIP-seq
MIRT1235144	hsa-miR-4652-3p	CLIP-seq
MIRT2069230	hsa-miR-4695-5p	CLIP-seq
MIRT1235147	hsa-miR-4713-5p	CLIP-seq
MIRT1235154	hsa-miR-506	CLIP-seq
MIRT1235156	hsa-miR-532-3p	CLIP-seq
MIRT2069231	hsa-miR-568	CLIP-seq
MIRT1235161	hsa-miR-603	CLIP-seq
MIRT2069232	hsa-miR-650	CLIP-seq
MIRT2069233	hsa-miR-668	CLIP-seq
MIRT1235101	hsa-miR-124	CLIP-seq
MIRT1235106	hsa-miR-129-5p	CLIP-seq
MIRT1235113	hsa-miR-2113	CLIP-seq
MIRT1235132	hsa-miR-4286	CLIP-seq
MIRT1235154	hsa-miR-506	CLIP-seq
MIRT2296313	hsa-miR-711	CLIP-seq
MIRT1235113	hsa-miR-2113	CLIP-seq
MIRT1235121	hsa-miR-329	CLIP-seq
MIRT1235124	hsa-miR-362-3p	CLIP-seq
MIRT1235131	hsa-miR-3941	CLIP-seq
MIRT1235144	hsa-miR-4652-3p	CLIP-seq
MIRT1235161	hsa-miR-603	CLIP-seq
MIRT2439499	hsa-miR-1247	CLIP-seq
MIRT2439500	hsa-miR-4258	CLIP-seq
MIRT2439501	hsa-miR-4449	CLIP-seq
MIRT2439499	hsa-miR-1247	CLIP-seq
MIRT1235102	hsa-miR-1252	CLIP-seq
MIRT1235109	hsa-miR-1321	CLIP-seq
MIRT2594037	hsa-miR-185	CLIP-seq
MIRT2594038	hsa-miR-208a	CLIP-seq
MIRT2594039	hsa-miR-208b	CLIP-seq
MIRT1235117	hsa-miR-3126-5p	CLIP-seq
MIRT1235119	hsa-miR-3173-3p	CLIP-seq
MIRT1235120	hsa-miR-3202	CLIP-seq
MIRT2594040	hsa-miR-361-3p	CLIP-seq
MIRT2594041	hsa-miR-3617	CLIP-seq
MIRT1235126	hsa-miR-3673	CLIP-seq
MIRT1235127	hsa-miR-3688-3p	CLIP-seq
MIRT2594042	hsa-miR-3691-3p	CLIP-seq
MIRT2594043	hsa-miR-4257	CLIP-seq
MIRT2439500	hsa-miR-4258	CLIP-seq
MIRT2594044	hsa-miR-4272	CLIP-seq
MIRT2594045	hsa-miR-4290	CLIP-seq
MIRT2594046	hsa-miR-4306	CLIP-seq
MIRT1235135	hsa-miR-4419a	CLIP-seq
MIRT1235136	hsa-miR-4436b-3p	CLIP-seq
MIRT2439501	hsa-miR-4449	CLIP-seq
MIRT1235137	hsa-miR-4453	CLIP-seq
MIRT2594047	hsa-miR-4476	CLIP-seq
MIRT1235139	hsa-miR-4510	CLIP-seq
MIRT1235142	hsa-miR-4538	CLIP-seq
MIRT2594048	hsa-miR-4644	CLIP-seq
MIRT2594049	hsa-miR-4687-5p	CLIP-seq
MIRT1235146	hsa-miR-4710	CLIP-seq
MIRT1235149	hsa-miR-4739	CLIP-seq
MIRT1235150	hsa-miR-4756-5p	CLIP-seq
MIRT1235151	hsa-miR-4761-3p	CLIP-seq
MIRT2594050	hsa-miR-4768-3p	CLIP-seq
MIRT1235152	hsa-miR-4779	CLIP-seq
MIRT2594051	hsa-miR-499-5p	CLIP-seq
MIRT2594052	hsa-miR-641	CLIP-seq
MIRT1235163	hsa-miR-646	CLIP-seq
MIRT1235164	hsa-miR-671-5p	CLIP-seq
MIRT2439499	hsa-miR-1247	CLIP-seq
MIRT1235102	hsa-miR-1252	CLIP-seq
MIRT1235109	hsa-miR-1321	CLIP-seq
MIRT2687924	hsa-miR-15a	CLIP-seq
MIRT2687925	hsa-miR-15b	CLIP-seq
MIRT2687926	hsa-miR-16	CLIP-seq
MIRT2594037	hsa-miR-185	CLIP-seq
MIRT2687927	hsa-miR-195	CLIP-seq
MIRT2594038	hsa-miR-208a	CLIP-seq
MIRT2594039	hsa-miR-208b	CLIP-seq
MIRT1235114	hsa-miR-214	CLIP-seq
MIRT1235117	hsa-miR-3126-5p	CLIP-seq
MIRT1235119	hsa-miR-3173-3p	CLIP-seq
MIRT2594040	hsa-miR-361-3p	CLIP-seq
MIRT2594041	hsa-miR-3617	CLIP-seq
MIRT1235127	hsa-miR-3688-3p	CLIP-seq
MIRT2594042	hsa-miR-3691-3p	CLIP-seq
MIRT2687928	hsa-miR-424	CLIP-seq
MIRT2594043	hsa-miR-4257	CLIP-seq
MIRT2439500	hsa-miR-4258	CLIP-seq
MIRT2594044	hsa-miR-4272	CLIP-seq
MIRT2594045	hsa-miR-4290	CLIP-seq
MIRT2594046	hsa-miR-4306	CLIP-seq
MIRT1235135	hsa-miR-4419a	CLIP-seq
MIRT1235136	hsa-miR-4436b-3p	CLIP-seq
MIRT2439501	hsa-miR-4449	CLIP-seq
MIRT1235137	hsa-miR-4453	CLIP-seq
MIRT1235139	hsa-miR-4510	CLIP-seq
MIRT2687929	hsa-miR-4514	CLIP-seq
MIRT1235142	hsa-miR-4538	CLIP-seq
MIRT2594048	hsa-miR-4644	CLIP-seq
MIRT2687930	hsa-miR-4645-5p	CLIP-seq
MIRT2687931	hsa-miR-4673	CLIP-seq
MIRT2594049	hsa-miR-4687-5p	CLIP-seq
MIRT2687932	hsa-miR-4692	CLIP-seq
MIRT1235146	hsa-miR-4710	CLIP-seq
MIRT1235149	hsa-miR-4739	CLIP-seq
MIRT1235150	hsa-miR-4756-5p	CLIP-seq
MIRT1235151	hsa-miR-4761-3p	CLIP-seq
MIRT2594050	hsa-miR-4768-3p	CLIP-seq
MIRT1235152	hsa-miR-4779	CLIP-seq
MIRT2687933	hsa-miR-497	CLIP-seq
MIRT2594051	hsa-miR-499-5p	CLIP-seq
MIRT2594052	hsa-miR-641	CLIP-seq
MIRT1235163	hsa-miR-646	CLIP-seq
MIRT1235164	hsa-miR-671-5p	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
ABL1	Activation	15145216
ERG	Activation	22140532
STAT1	Unknown	10068671
STAT3	Activation	22273698
STAT3	Unknown	10068671
STAT4	Unknown	10068671

Show/Hide all(61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	1825810, 18056989, 18593906, 31548394, 37797010
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	16186805, 16266891, 18056989, 18593906, 25096571, 25416956, 30017192
GO:0005524	Function	ATP binding	IDA	1825810
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	16186805, 21474815
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	1825810, 21474815
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	16186805
GO:0005886	Component	Plasma membrane	IDA	16186805
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	1825810, 16266891, 18056989, 18593906
GO:0006915	Process	Apoptotic process	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0008134	Function	Transcription factor binding	IPI	18593906
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0022898	Process	Regulation of transmembrane transporter activity	IMP	18056989
GO:0030145	Function	Manganese ion binding	IDA	1825810
GO:0030145	Function	Manganese ion binding	IEA
GO:0031669	Process	Cellular response to nutrient levels	IDA	31601708
GO:0034198	Process	Cellular response to amino acid starvation	IDA	35338845
GO:0042742	Process	Defense response to bacterium	IDA	31268602
GO:0043024	Function	Ribosomal small subunit binding	IPI	16266891
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	16186805
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043433	Process	Negative regulation of DNA-binding transcription factor activity	IDA	18593906
GO:0043539	Function	Protein serine/threonine kinase activator activity	IMP	16186805
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	18593906
GO:0045824	Process	Negative regulation of innate immune response	IDA	37797010
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	16266891
GO:0046777	Process	Protein autophosphorylation	IMP	18593906
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0051715	Process	Cytolysis in another organism	IDA	31268602
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IDA	21474815
GO:0070561	Process	Vitamin D receptor signaling pathway	IMP	22720752
GO:0071346	Process	Cellular response to type II interferon	IDA	37797010
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IMP	16186805
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	31268602
GO:1902033	Process	Regulation of hematopoietic stem cell proliferation	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	35338845
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	31601708
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	31548394
GO:1905062	Process	Positive regulation of cardioblast proliferation	IDA	21474815
GO:1990748	Process	Cellular detoxification	IMP	18056989

MIM	HGNC	e!Ensembl
164960	8986	ENSG00000137193

Protein

UniProt ID

P11309

Protein name

Serine/threonine-protein kinase pim-1 (EC 2.7.11.1)

Protein function

Proto-oncogene with serine/threonine kinase activity involved in cell survival and cell proliferation and thus providing a selective advantage in tumorigenesis (PubMed:15528381, PubMed:1825810, PubMed:31548394). Exerts its oncogenic activity thr

PDB

1XQZ , 1XR1 , 1XWS , 1YHS , 1YI3 , 1YI4 , 1YWV , 1YXS , 1YXT , 1YXU , 1YXV , 1YXX , 2BIK , 2BIL , 2BZH , 2BZI , 2BZJ , 2BZK , 2C3I , 2J2I , 2O3P , 2O63 , 2O64 , 2O65 , 2OBJ , 2OI4 , 2XIX , 2XIY , 2XIZ , 2XJ0 , 2XJ1 , 2XJ2 , 3A99 , 3BGP , 3BGQ , 3BGZ , 3BWF , 3C4E , 3CXW , 3CY2 , 3CY3 , 3DCV , 3F2A , 3JPV , 3JXW , 3JY0 , 3JYA , 3MA3 , 3QF9 , 3R00 , 3R01

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	38 → 290	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed primarily in cells of the hematopoietic and germline lineages. Isoform 1 and isoform 2 are both expressed in prostate cancer cell lines. {ECO:0000269|PubMed:16186805}.

Sequence

MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK

Sequence length

313

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioblastoma	Glioblastoma	N/A	N/A	GWAS
Hypertension	ICD10 127.0 pulmonary arterial hypertension	N/A	N/A	GWAS
Prostate cancer	Prostate cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (97)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	16505280
alpha 1 Antitrypsin Deficiency	Stimulate	38046982
Arthritis Rheumatoid	Associate	30753680
Astrocytoma	Stimulate	27088547
Astrocytoma	Associate	36260562
Autoimmune Diseases	Associate	25096571
Breast Neoplasms	Associate	24909179, 27590579, 27604488, 30989585, 32307917, 34193159, 34666190, 40708207
Burkitt Lymphoma	Associate	27641442
Carcinogenesis	Associate	17643117, 21143989, 25121590, 25342548, 25551195, 32430337, 33762119, 34679086, 34818069
Carcinoma	Associate	18708761
Carcinoma Adenoid Cystic	Associate	25551195, 28228352
Carcinoma Hepatocellular	Associate	28387905, 29093516
Carcinoma Non Small Cell Lung	Associate	23119061, 25342548
Carcinoma Pancreatic Ductal	Associate	18708761, 21262926
Carcinoma Pancreatic Ductal	Stimulate	37943821
Carcinoma Renal Cell	Associate	26472029, 35285410
Cardiomyopathies	Associate	24401608
Cell Transformation Neoplastic	Associate	29516572, 34193159
Central Nervous System Infections	Associate	37678673
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Associate	22986532
Colorectal Neoplasms	Associate	19638618, 22465712, 24116137, 29516572, 37621144
Complement component 5 deficiency	Associate	37730436
Drug Related Side Effects and Adverse Reactions	Associate	24975213
Drug Resistant Epilepsy	Associate	36606708
Epstein Barr Virus Infections	Associate	33202420
Esophageal Neoplasms	Associate	27983525
Glioblastoma	Associate	22544323, 30718520
Head and Neck Neoplasms	Associate	19568408
Heart Diseases	Associate	33225891
Heart Failure	Associate	24044948
Hematologic Neoplasms	Associate	2682662, 34679086
Hepatoblastoma	Associate	33762119
Hereditary Breast and Ovarian Cancer Syndrome	Associate	27590579, 35937947
Hereditary leiomyomatosis and renal cell cancer	Associate	37910143
Hodgkin Disease	Associate	37910143
Hypotension	Associate	32504181
Hypoxia	Stimulate	18708761, 19483729
Hypoxia	Associate	26387536, 26990493
Hypoxia Brain	Stimulate	18708761
Hypoxia Brain	Associate	19483729
Inflammation	Associate	10557283
Leukemia	Associate	18077363, 26375673, 2682662, 2837645, 30185437, 31671637, 37730436
Leukemia Lymphoma Adult T Cell	Associate	16603085, 34818069
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26375673
Leukemia Myeloid Acute	Associate	19734423, 21802138, 23036488, 27054578, 28851457, 31434952, 3458216, 34679086
Leukemia Prolymphocytic T Cell	Associate	29665227, 29978459
Lung Neoplasms	Associate	20521180, 26916442
Lung Neoplasms	Stimulate	25342548
Lupus Erythematosus Systemic	Associate	37072752
Lymphatic Metastasis	Stimulate	20032391, 25342548
Lymphatic Metastasis	Associate	23119061
Lymphoma	Associate	14592832, 16418334, 24970810, 30227305, 31671637, 33202420, 33581493, 34325497, 34448823, 34818069, 36881367, 37475138, 37657032, 37730436, 37975847
Lymphoma B Cell	Associate	16418334, 21937691, 32973328, 33307035, 36221796
Lymphoma B Cell Marginal Zone	Associate	17197434, 37941429
Lymphoma Follicular	Associate	35030632, 36994552
Lymphoma Large B Cell Diffuse	Associate	22722314, 26643319, 28479318, 28841204, 31483572, 32139889, 32469082, 33479306, 33945543, 34374220, 36811800, 37093346, 37730436, 37941429
Lymphoma Mantle Cell	Stimulate	12472567
Lymphoma Mantle Cell	Associate	19021050
Lymphoma Non Hodgkin	Associate	12714522
Lymphoma T Cell	Associate	30020405
Lymphoma T Cell	Stimulate	3458216
Lymphoma T Cell Peripheral	Associate	25386922
Lymphoproliferative Disorders	Associate	37705050
Mesothelioma	Associate	33955505
Mesothelioma Malignant	Associate	33955505
Mitochondrial Diseases	Associate	24401608
Mitochondrial Diseases	Stimulate	28170315
Multiple Myeloma	Associate	22267603, 27564460, 35108359
Nasopharyngeal Carcinoma	Associate	22840454
Neoplasm Invasiveness	Associate	25551195
Neoplasm Metastasis	Stimulate	26687194
Neoplasm Metastasis	Associate	29516572, 32873828, 32914663, 32963582
Neoplasms	Associate	16505280, 19483729, 19638618, 20032391, 21143989, 22465712, 22700982, 22722314, 23755147, 24116137, 24975213, 25342548, 25451079, 26406598, 26472029 View all (23 more)
Neoplasms	Stimulate	21262926, 26352175, 29516572, 34818069
Neuroblastoma	Associate	36907773
Osteosarcoma	Associate	26687194, 30103304, 32963582
Ovarian Neoplasms	Associate	25080901
Pancreatic Neoplasms	Stimulate	18708761
Pancreatic Neoplasms	Associate	23760491, 26387536, 27596051, 37943821
Paraplegia	Stimulate	15308563
Peritonitis	Associate	34448823
Philadelphia Chromosome	Associate	26375673
Plasmablastic Lymphoma	Associate	34714908
Polycythemia Vera	Associate	26491227
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24975213, 30185437, 32146726
Prostatic Neoplasms	Associate	11518967, 18056989, 18426800, 22080570, 22193779, 22261337, 22986532, 25451079, 26990493, 31730483, 32873828, 33398037, 33932111, 34679086, 34697370, 37042842 View all (1 more)
Prostatic Neoplasms Castration Resistant	Stimulate	33932111
Prostatitis	Associate	16505280, 22080570, 33398037
Sarcoma Kaposi	Associate	37032379, 37730436
Sjogren's Syndrome	Associate	34261974
Small Cell Lung Carcinoma	Stimulate	32504181
Stomach Neoplasms	Associate	20032391, 26352175, 28742204, 29879757, 37493631
Testicular Germ Cell Tumor	Associate	39258697
Thyroid Cancer Papillary	Associate	33383107
Triple Negative Breast Neoplasms	Associate	32976598
Urinary Bladder Neoplasms	Associate	21143989
Uterine Cervical Neoplasms	Associate	32914663

PIM1 (Pim-1 proto-oncogene, serine/threonine kinase)