Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	146850
Gene name Gene Name - the full gene name approved by the HGNC.	Phosphoinositide-3-kinase regulatory subunit 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	PIK3R6
Synonyms (NCBI Gene) Gene synonyms aliases	C17orf38, HsT41028, p84 PIKAP, p87(PIKAP), p87PIKAP
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	Phosphoinositide 3-kinase gamma is a lipid kinase that produces the lipid second messenger phosphatidylinositol 3,4,5-trisphosphate. The kinase is composed of a catalytic subunit and one of several regulatory subunits, and is chiefly activated by G protei

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments
MIRT1234905	hsa-miR-1343	CLIP-seq
MIRT1234906	hsa-miR-142-3p	CLIP-seq
MIRT1234907	hsa-miR-2861	CLIP-seq
MIRT1234908	hsa-miR-362-5p	CLIP-seq
MIRT1234909	hsa-miR-3667-3p	CLIP-seq
MIRT1234910	hsa-miR-3713	CLIP-seq
MIRT1234911	hsa-miR-4280	CLIP-seq
MIRT1234912	hsa-miR-4691-5p	CLIP-seq
MIRT1234913	hsa-miR-500b	CLIP-seq
MIRT1234914	hsa-miR-501-5p	CLIP-seq
MIRT2069177	hsa-miR-149	CLIP-seq
MIRT2069178	hsa-miR-3176	CLIP-seq
MIRT2069179	hsa-miR-3922-3p	CLIP-seq
MIRT2069180	hsa-miR-3926	CLIP-seq
MIRT2069181	hsa-miR-548s	CLIP-seq
MIRT2069182	hsa-miR-760	CLIP-seq
MIRT2069177	hsa-miR-149	CLIP-seq
MIRT2296302	hsa-miR-3064-5p	CLIP-seq
MIRT2296303	hsa-miR-3650	CLIP-seq
MIRT2296304	hsa-miR-3659	CLIP-seq
MIRT2296305	hsa-miR-4658	CLIP-seq
MIRT2296306	hsa-miR-4687-3p	CLIP-seq
MIRT2296307	hsa-miR-4794	CLIP-seq
MIRT2296308	hsa-miR-574-5p	CLIP-seq
MIRT2392526	hsa-miR-1262	CLIP-seq
MIRT2392527	hsa-miR-1293	CLIP-seq
MIRT2392528	hsa-miR-297	CLIP-seq
MIRT2392529	hsa-miR-3150a-3p	CLIP-seq
MIRT2392530	hsa-miR-3175	CLIP-seq
MIRT2296303	hsa-miR-3650	CLIP-seq
MIRT2392531	hsa-miR-378g	CLIP-seq
MIRT2392532	hsa-miR-4300	CLIP-seq
MIRT2392533	hsa-miR-4453	CLIP-seq
MIRT2392534	hsa-miR-4483	CLIP-seq
MIRT2392535	hsa-miR-4538	CLIP-seq
MIRT2392536	hsa-miR-4701-3p	CLIP-seq
MIRT2392537	hsa-miR-567	CLIP-seq
MIRT2392538	hsa-miR-920	CLIP-seq
MIRT2392539	hsa-miR-939	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0005515	Function	Protein binding	IPI	21393242
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005942	Component	Phosphatidylinositol 3-kinase complex	IBA
GO:0005943	Component	Phosphatidylinositol 3-kinase complex, class IA	EXP	10358071
GO:0005944	Component	Phosphatidylinositol 3-kinase complex, class IB	IEA
GO:0005944	Component	Phosphatidylinositol 3-kinase complex, class IB	ISS
GO:0006955	Process	Immune response	NAS	31480354
GO:0007186	Process	G protein-coupled receptor signaling pathway	EXP	10358071
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0042269	Process	Regulation of natural killer cell mediated cytotoxicity	IBA
GO:0042269	Process	Regulation of natural killer cell mediated cytotoxicity	IDA	11062502
GO:0043406	Process	Positive regulation of MAP kinase activity	ISS
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	21393242
GO:0046934	Function	1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity	IEA
GO:0046934	Function	1-phosphatidylinositol-4,5-bisphosphate 3-kinase activity	ISS
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	IBA
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	IEA
GO:0046935	Function	1-phosphatidylinositol-3-kinase regulator activity	ISS

MIM	HGNC	e!Ensembl
611462	27101	ENSG00000276231

Protein

UniProt ID

Q5UE93

Protein name

Phosphoinositide 3-kinase regulatory subunit 6 (Phosphoinositide 3-kinase gamma adapter protein of 87 kDa) (p84 PI3K adapter protein) (p84 PIKAP) (p87 PI3K adapter protein) (p87PIKAP)

Protein function

Regulatory subunit of the PI3K gamma complex. Acts as an adapter to drive activation of PIK3CG by beta-gamma G protein dimers. The PIK3CG:PIK3R6 heterodimer is much less sensitive to beta-gamma G protein dimers than PIK3CG:PIK3R5 and its membran

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10486	PI3K_1B_p101	6 → 300	Phosphoinositide 3-kinase gamma adapter protein p101 subunit	Family
PF10486	PI3K_1B_p101	395 → 474	Phosphoinositide 3-kinase gamma adapter protein p101 subunit	Family
PF10486	PI3K_1B_p101	468 → 753	Phosphoinositide 3-kinase gamma adapter protein p101 subunit	Family

Sequence

MESSDVELDLQRSVQAVLRELSTQAPALQSNQGMWRWSLHKKVERDPGKSPVLVRILLRE
LEKAESQDLRHVIIPLLHTVMYVLTKATGITEELYQRIYAFCTRLLTLPTPYCTVALDCA
IRLKTEMAVPGTLYQRMVIAEQNLTNELYPYQERVFLFVDPELVSASVCSALLLEIEAAQ
AQQTPETCMRHVVSHALQAALGEACHAGALHRKLQASPRRTLEHYFHAVVAALEQMASEA
SPSREGHVERLEEIYCSLLGPAAGRCGGDLVQERPPSIPLPSPYITFHLWTGEEQLWKEL
VLFLRPRSQLRLSADLEVLDLQGLRPDRELARVSVLSTDSGIERDLPTGADELPAPGSPE
MERAGLQRKGGIKKRAWPLDFLMPGSWDGPPGLHRRTGRPSGDGEMLPGVSRLHTARVLV
LGDDRMLGRLAQAYHRLRKRETQKFCLTPRLSLQLYYIPVLAPEKPAASRQPELGELATF
LGRVDPWYQSNVNTLCPAIHKLAEMPPSLDTSRTVDPFILDVITYYIRMGTQPIYFQIYT
VKIFFSDLSQDPTEDIFLIELKVKIQDSKFPKDGFSPRRRGVAEGPGAELSLCYQKALLS
HRPREVTVSLRATGLILKAIPASDTEVSGSSHCPLPAAPVTDHTCLNVNVTEVVKSSNLA
GKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSK
APWLNLHGQQEVEAIKAKPKPLLMPINTFSGIVQ

Sequence length

754

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	37708538
Neoplasms	Associate	35885996, 37708538

PIK3R6 (phosphoinositide-3-kinase regulatory subunit 6)