Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5290
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PIK3CA
Synonyms (NCBI Gene) Gene synonyms aliases
CCM4, CLAPO, CLOVE, CWS5, HMH, MCAP, MCM, MCMTC, PI3K, PI3K-alpha, p110-alpha
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q26.32
Summary Summary of gene provided in NCBI Entrez Gene.
Phosphatidylinositol 3-kinase is composed of an 85 kDa regulatory subunit and a 110 kDa catalytic subunit. The protein encoded by this gene represents the catalytic subunit, which uses ATP to phosphorylate PtdIns, PtdIns4P and PtdIns(4,5)P2. This gene has
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104886003 G>A,C Pathogenic, pathogenic-likely-pathogenic, likely-pathogenic, drug-response, not-provided Missense variant, coding sequence variant
rs121913272 T>C,G Pathogenic, likely-pathogenic Missense variant, coding sequence variant
rs121913273 G>A,C Pathogenic, likely-pathogenic Missense variant, coding sequence variant
rs121913274 A>C,G,T Pathogenic, pathogenic-likely-pathogenic, likely-pathogenic Missense variant, coding sequence variant
rs121913275 G>A,C,T Pathogenic, likely-pathogenic, likely-benign Missense variant, synonymous variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006837 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR, Western blot 22940133
MIRT006837 hsa-miR-124-3p Luciferase reporter assay, qRT-PCR, Western blot 22940133
MIRT007316 hsa-miR-148b-3p Western blot 23238785
MIRT007316 hsa-miR-148b-3p Western blot 23238785
MIRT017306 hsa-miR-335-5p Microarray 18185580
Transcription factors
Transcription factor Regulation Reference
FOXO3 Unknown 19299143
HIF1A Unknown 23060442
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001525 Process Angiogenesis IEA
GO:0001889 Process Liver development IEA
GO:0001944 Process Vasculature development TAS 19200708
GO:0004674 Function Protein serine/threonine kinase activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
171834 8975 ENSG00000121879
Protein
UniProt ID P42336
Protein name Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PI3-kinase subunit alpha) (PI3K-alpha) (PI3Kalpha) (PtdIns-3-kinase subunit alpha) (EC 2.7.1.137) (EC 2.7.1.153) (Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa cataly
Protein function Phosphoinositide-3-kinase (PI3K) phosphorylates phosphatidylinositol (PI) and its phosphorylated derivatives at position 3 of the inositol ring to produce 3-phosphoinositides (PubMed:15135396, PubMed:23936502, PubMed:28676499). Uses ATP and PtdI
PDB 2ENQ , 2RD0 , 3HHM , 3HIZ , 3ZIM , 4JPS , 4L1B , 4L23 , 4L2Y , 4OVU , 4OVV , 4TUU , 4TV3 , 4WAF , 4YKN , 4ZOP , 5DXH , 5DXT , 5FI4 , 5ITD , 5SW8 , 5SWG , 5SWO , 5SWP , 5SWR , 5SWT , 5SX8 , 5SX9 , 5SXA , 5SXB , 5SXC , 5SXD , 5SXE , 5SXF , 5SXI , 5SXJ , 5SXK , 5UBR , 5UK8 , 5UKJ , 5UL1 , 5XGH , 5XGI , 5XGJ , 6GVF , 6GVG , 6GVH , 6GVI , 6NCT , 6OAC , 6PYS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02192 PI3K_p85B 32 107 PI3-kinase family, p85-binding domain Family
PF00794 PI3K_rbd 173 292 PI3-kinase family, ras-binding domain Domain
PF00792 PI3K_C2 350 485 Phosphoinositide 3-kinase C2 Domain
PF00613 PI3Ka 519 704 Phosphoinositide 3-kinase family, accessory domain (PIK domain) Family
PF00454 PI3_PI4_kinase 796 1015 Phosphatidylinositol 3- and 4-kinase Family
Sequence
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGN
REEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKES
LYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVK
FPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNR
QVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQS
FDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Sequence length 1068
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
CLOVES Syndrome cloves syndrome rs397517199, rs1057519925, rs121913279, rs121913273, rs397517202, rs121913287, rs1057519929, rs121913272 N/A
Cowden Syndrome cowden syndrome, cowden syndrome 5, Cowden syndrome 1 rs1057519929, rs587777792, rs121913272, rs587776933, rs121913288, rs587777793, rs886042002, rs587777796, rs1576947658, rs121913287, rs1057519942, rs121913283, rs587776932, rs1057519925, rs1064793663
View all (10 more)
N/A
Endometrial carcinoma endometrial carcinoma rs1553826166 N/A
Megalencephaly-Capillary Malformation-Polymicrogyria Syndrome megalencephaly-capillary malformation-polymicrogyria syndrome rs587776933, rs886042002, rs104886003, rs121913277, rs1057519925, rs587776932, rs1576935161, rs1724674149, rs121913287, rs121913283, rs397514565, rs1064793349, rs121913281, rs121913279, rs867262025
View all (5 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Carcinoma hereditary breast carcinoma N/A N/A GenCC
colorectal cancer Colorectal cancer N/A N/A ClinVar
Ovarian cancer familial ovarian cancer N/A N/A GenCC
polycystic kidney disease Polycystic kidney disease N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
3 methylcrotonyl CoA carboxylase 1 deficiency Associate 22363598
Abdominal Injuries Associate 27033063
Abdominal Pain Associate 35787784
Acidemia isovaleric Associate 30075505
ACTH Secreting Pituitary Adenoma Associate 22782554
Adenocarcinoma Associate 22430133, 22450065, 23196793, 23525077, 24299561, 24533074, 24823994, 25220666, 25426553, 25473901, 26197069, 26317919, 26536055, 26884879, 26998897
View all (15 more)
Adenocarcinoma Follicular Associate 34171097, 39336800
Adenocarcinoma Mucinous Associate 27982025, 29793804
Adenocarcinoma of Lung Associate 17487277, 20855837, 22135231, 22975805, 23802852, 24453288, 24700479, 25546673, 26066407, 26098749, 26334752, 27007084, 27060149, 27151654, 27304188
View all (19 more)
Adenocarcinoma Papillary Associate 21423156