Gene Gene information from NCBI Gene database.
Entrez ID 4852
Gene name Neuropeptide Y
Gene symbol NPY
Synonyms (NCBI Gene)
PYY4
Chromosome 7
Chromosome location 7p15.3
Summary This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neurope
miRNA miRNA information provided by mirtarbase database.
1
miRTarBase ID miRNA Experiments Reference
MIRT016709 hsa-miR-335-5p Microarray 18185580
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
CREB1 Unknown 12967770
FOS Unknown 8036020
JUN Unknown 8036020
SP1 Unknown 2376581
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
61
GO ID Ontology Definition Evidence Reference
GO:0001664 Function G protein-coupled receptor binding IEA
GO:0001878 Process Response to yeast IDA 18603306
GO:0002865 Process Negative regulation of acute inflammatory response to antigenic stimulus IEA
GO:0004930 Function G protein-coupled receptor activity TAS 1321422
GO:0005102 Function Signaling receptor binding TAS 8132547, 10698177
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
162640 7955 ENSG00000122585
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P01303
Protein name Pro-neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)]
Protein function NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
PDB 1QFA , 1RON , 7RTA , 7VGX , 7X9A , 7X9B , 7YOO , 8K6M , 8K6N , 8K6O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00159 Hormone_3 30 64 Pancreatic hormone peptide Family
Tissue specificity TISSUE SPECIFICITY: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Sequence
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
RQRY
GKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Sequence length 97
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
NPY POLYMORPHISM Benign rs16139 RCV000015068
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Injuries Associate 21937627, 26156739
Adrenal Gland Neoplasms Associate 7593641
Alcoholism Associate 18828811
Allergic Fungal Sinusitis Associate 32029445
Alzheimer Disease Associate 24028428, 36635346
Amyotrophic Lateral Sclerosis Stimulate 30911572
Anorexia Associate 21545413
Anxiety Associate 18385673, 20037921, 20648632, 21917383, 22584873, 29670288, 35093384
Anxiety Disorders Associate 25059547
Asthma Stimulate 32029445