Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4852
Gene name Gene Name - the full gene name approved by the HGNC.
Neuropeptide Y
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NPY
Synonyms (NCBI Gene) Gene synonyms aliases
PYY4
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p15.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neurope
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016709 hsa-miR-335-5p Microarray 18185580
Transcription factors
Transcription factor Regulation Reference
CREB1 Unknown 12967770
FOS Unknown 8036020
JUN Unknown 8036020
SP1 Unknown 2376581
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001664 Function G protein-coupled receptor binding IEA
GO:0001878 Process Response to yeast IDA 18603306
GO:0002865 Process Negative regulation of acute inflammatory response to antigenic stimulus IEA
GO:0004930 Function G protein-coupled receptor activity TAS 1321422
GO:0005102 Function Signaling receptor binding TAS 8132547, 10698177
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
162640 7955 ENSG00000122585
Protein
UniProt ID P01303
Protein name Pro-neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY); C-flanking peptide of NPY (CPON)]
Protein function NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
PDB 1QFA , 1RON , 7RTA , 7VGX , 7X9A , 7X9B , 7YOO , 8K6M , 8K6N , 8K6O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00159 Hormone_3 30 64 Pancreatic hormone peptide Family
Tissue specificity TISSUE SPECIFICITY: One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
Sequence
MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT
RQRY
GKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Sequence length 97
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma (childhood onset) N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Periodontitis Periodontitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Injuries Associate 21937627, 26156739
Adrenal Gland Neoplasms Associate 7593641
Alcoholism Associate 18828811
Allergic Fungal Sinusitis Associate 32029445
Alzheimer Disease Associate 24028428, 36635346
Amyotrophic Lateral Sclerosis Stimulate 30911572
Anorexia Associate 21545413
Anxiety Associate 18385673, 20037921, 20648632, 21917383, 22584873, 29670288, 35093384
Anxiety Disorders Associate 25059547
Asthma Stimulate 32029445