Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	50507
Gene name Gene Name - the full gene name approved by the HGNC.	NADPH oxidase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NOX4
Synonyms (NCBI Gene) Gene synonyms aliases	KOX, KOX-1, RENOX
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q14.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular

Show/Hide all(86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019477	hsa-miR-148b-3p	Microarray	17612493
MIRT437922	rno-miR-25-3p	Luciferase reporter assay	23722270
MIRT437922	rno-miR-25-3p	Luciferase reporter assay	23722270
MIRT756008	hsa-miR-99a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26986073
MIRT734718	hsa-miR-214-3p	Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	32051833
MIRT755591	hsa-miR-182-5p	Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence, ELISA	37737899
MIRT756008	hsa-miR-99a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35135443
MIRT1190255	hsa-miR-34b	CLIP-seq
MIRT1190256	hsa-miR-34c-3p	CLIP-seq
MIRT1190257	hsa-miR-3545-3p	CLIP-seq
MIRT1190258	hsa-miR-4256	CLIP-seq
MIRT1190259	hsa-miR-4635	CLIP-seq
MIRT1190260	hsa-miR-4680-5p	CLIP-seq
MIRT1190261	hsa-miR-4714-5p	CLIP-seq
MIRT1190262	hsa-miR-548g	CLIP-seq
MIRT1190263	hsa-miR-640	CLIP-seq
MIRT1190257	hsa-miR-3545-3p	CLIP-seq
MIRT1190264	hsa-miR-3663-5p	CLIP-seq
MIRT1190258	hsa-miR-4256	CLIP-seq
MIRT1190265	hsa-miR-4273	CLIP-seq
MIRT1190266	hsa-miR-4303	CLIP-seq
MIRT1190267	hsa-miR-4517	CLIP-seq
MIRT1190259	hsa-miR-4635	CLIP-seq
MIRT1190268	hsa-miR-4677-5p	CLIP-seq
MIRT1190260	hsa-miR-4680-5p	CLIP-seq
MIRT1190261	hsa-miR-4714-5p	CLIP-seq
MIRT1190263	hsa-miR-640	CLIP-seq
MIRT1190269	hsa-miR-1271	CLIP-seq
MIRT1190270	hsa-miR-182	CLIP-seq
MIRT1190271	hsa-miR-3622a-5p	CLIP-seq
MIRT1190272	hsa-miR-375	CLIP-seq
MIRT1190273	hsa-miR-4258	CLIP-seq
MIRT1190274	hsa-miR-4423-3p	CLIP-seq
MIRT1190275	hsa-miR-4428	CLIP-seq
MIRT1190276	hsa-miR-4642	CLIP-seq
MIRT1190277	hsa-miR-4775	CLIP-seq
MIRT1190278	hsa-miR-498	CLIP-seq
MIRT1190279	hsa-miR-590-3p	CLIP-seq
MIRT1190280	hsa-miR-9	CLIP-seq
MIRT1190281	hsa-miR-96	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT1190275	hsa-miR-4428	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT2055110	hsa-miR-1237	CLIP-seq
MIRT2055111	hsa-miR-1248	CLIP-seq
MIRT2055112	hsa-miR-1303	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT2055113	hsa-miR-370	CLIP-seq
MIRT2055114	hsa-miR-3977	CLIP-seq
MIRT1190273	hsa-miR-4258	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT2284061	hsa-miR-935	CLIP-seq
MIRT2055110	hsa-miR-1237	CLIP-seq
MIRT2055111	hsa-miR-1248	CLIP-seq
MIRT2055112	hsa-miR-1303	CLIP-seq
MIRT2055113	hsa-miR-370	CLIP-seq
MIRT2055114	hsa-miR-3977	CLIP-seq
MIRT2439047	hsa-miR-129-5p	CLIP-seq
MIRT2439047	hsa-miR-129-5p	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
E2F1	Activation	18554521
NFKB1	Activation	20622120
RELA	Activation	20622120
SP3	Activation	21235713
STAT1	Unknown	19834108
STAT3	Unknown	19834108
STAT4	Unknown	19834108

Show/Hide all(72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	TAS	10869423
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000902	Process	Cell morphogenesis	ISS	10869423
GO:0003015	Process	Heart process	IEA
GO:0003015	Process	Heart process	IGI	27525436
GO:0005515	Function	Protein binding	IPI	15356101, 17064675
GO:0005634	Component	Nucleus	IDA	16324151, 23393389
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS	27525436
GO:0005730	Component	Nucleolus	IDA	23393389
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS	27525436
GO:0005783	Component	Endoplasmic reticulum	IDA	21343298
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	15927447
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16019190, 21343298
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IEA
GO:0006801	Process	Superoxide metabolic process	IDA	18760347
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0006952	Process	Defense response	IBA
GO:0006954	Process	Inflammatory response	TAS	10869423
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS	10869423
GO:0009055	Function	Electron transfer activity	TAS	10869423
GO:0010467	Process	Gene expression	IMP	23144758
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10869423
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IBA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IDA	14966267, 15356101, 15927447, 25062272
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IMP	21343298
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	TAS	10869423
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IBA
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IDA	15721269
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IDA	10869423, 11032835, 15155719, 15721269, 15927447, 16019190, 16179589, 16230378, 16324151, 23393389, 25062272
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019826	Function	Oxygen sensor activity	TAS	10869423
GO:0020037	Function	Heme binding	IDA	25062272
GO:0020037	Function	Heme binding	TAS	10869423
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS	27525436
GO:0042554	Process	Superoxide anion generation	IBA
GO:0042554	Process	Superoxide anion generation	IEA
GO:0042554	Process	Superoxide anion generation	ISS	10869423
GO:0043020	Component	NADPH oxidase complex	IBA
GO:0045453	Process	Bone resorption	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15721269
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS	27525436
GO:0050660	Function	Flavin adenine dinucleotide binding	TAS	10869423
GO:0050667	Process	Homocysteine metabolic process	IDA	20031578
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0072341	Function	Modified amino acid binding	IDA	20031578
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0097038	Component	Perinuclear endoplasmic reticulum	ISS	27525436
GO:0106292	Function	Superoxide-generating NADPH oxidase activity	IEA
GO:1903409	Process	Reactive oxygen species biosynthetic process	NAS	27525436
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	ISS	27525436
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
605261	7891	ENSG00000086991

Protein

UniProt ID

Q9NPH5

Protein name

NADPH oxidase 4 (EC 1.6.3.1) (Kidney oxidase-1) (KOX-1) (Kidney superoxide-producing NADPH oxidase) (Renal NAD(P)H-oxidase)

Protein function

NADPH oxidase that catalyzes predominantly the reduction of oxygen to H2O2 (PubMed:14966267, PubMed:15356101, PubMed:15927447, PubMed:21343298, PubMed:25062272). Can also catalyze to a smaller extent, the reduction of oxygen to superoxide (PubMe

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01794	Ferric_reduct	58 → 205	Ferric reductase like transmembrane component	Family
PF08022	FAD_binding_8	306 → 417	FAD-binding domain	Domain
PF08030	NAD_binding_6	423 → 561	Ferric reductase NAD binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, br

Sequence

MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS
ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV
AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY
AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP
EYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY
RYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP
TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH
NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK
TVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS

Sequence length

578

Interactions

View interactions

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Severe diabetic retinopathy in type 2 diabetes	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Melanoma	Melanoma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (112)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acute Lung Injury	Associate	33757467
Adenocarcinoma	Associate	30813866
Adrenoleukodystrophy	Associate	25252997
Arthritis Rheumatoid	Associate	32414400, 37174663
Asthma	Associate	17369289
Asthma	Stimulate	22108207
Atherosclerosis	Associate	15572675, 19526729, 20360249
Breast Neoplasms	Stimulate	40634441
Carcinogenesis	Associate	21915726, 28422720, 37392558, 40634441
Carcinoma Hepatocellular	Associate	27282266, 27941881, 28894215, 29237157, 36964576, 37463530
Carcinoma Non Small Cell Lung	Associate	24946933, 30273693, 37392558
Carcinoma Pancreatic Ductal	Associate	21118808
Carcinoma Renal Cell	Associate	16230378, 22303451, 32356935, 32492552
Carcinosarcoma	Inhibit	30813866
Cardiomyopathies	Associate	35090586
Chemical and Drug Induced Liver Injury	Associate	32330605
Colonic Neoplasms	Associate	33140821
Colorectal Neoplasms	Associate	21656576, 25096929, 28422720, 32641980
COVID 19	Associate	36498845
Death	Stimulate	32492552
Diabetes Mellitus	Associate	30813866
Diabetes Mellitus Insulin Dependent 19	Associate	24309190
Diabetes Mellitus Type 2	Associate	30178632
Diabetic Nephropathies	Associate	19415232
Diabetic Retinopathy	Associate	23144758, 30178632, 36506045
Drug Related Side Effects and Adverse Reactions	Associate	20360249
Dyslipidemias	Associate	32641980
Endometrial Neoplasms	Associate	30813866
Endometriosis	Associate	39672281
Epiretinal Membrane	Associate	36567907
Esophageal Neoplasms	Stimulate	28578276
Fibrosis	Associate	25888935, 32330605, 36608994
Fuchs' Endothelial Dystrophy	Associate	29852040, 31847785
Glioblastoma	Associate	24868315, 35203105
Glioma	Associate	24868315
Granulomatous Disease Chronic	Associate	25252997
Graves Disease	Stimulate	35008579
Graves Ophthalmopathy	Associate	35008579
Head and Neck Neoplasms	Stimulate	28578276
Hearing Loss	Associate	34847940
Heart Defects Congenital	Associate	35035663
Heart Failure	Stimulate	18387435, 26449263
Hepatitis B	Associate	31106596
HIV Infections	Stimulate	28314381
Hyperglycemia	Stimulate	22572850
Hyperglycemia	Associate	28840773
Hyperphosphatemia	Associate	25278128
Hypertension Pulmonary	Associate	29986678
Hypertrophy	Associate	17369289, 36840500
Hypoxia	Associate	19036873, 22303451, 29237157
Hypoxia	Stimulate	24520084, 25557278, 29426376, 33499904, 35377824, 40222298
Hypoxia Brain	Stimulate	29237157, 37246768
Idiopathic Pulmonary Fibrosis	Stimulate	20685750, 31119153
Idiopathic Pulmonary Fibrosis	Associate	33325804
Immune System Diseases	Associate	28314381
Inflammation	Associate	22303451, 24621786, 25298619, 26867675, 29671417, 30315526, 33859775, 35140544, 36840500, 36899420, 37174663, 38382869
Intervertebral Disc Degeneration	Associate	36899420
Keloid	Associate	36608994
Kidney Neoplasms	Associate	16230378
Leiomyoma	Stimulate	24520084
Leiomyoma	Associate	35377824
Leukemia Lymphocytic Chronic B Cell	Associate	36764627
Liver Cirrhosis	Associate	28855398, 35035671
Lung Diseases	Associate	19036873, 28855398
Lung Neoplasms	Associate	28081539
Melanoma	Associate	11997235, 24911159, 33451139
Melanoma	Stimulate	28578276
Metabolic Syndrome	Associate	25888935
Mitochondrial Diseases	Associate	36915111
Multiple System Atrophy	Associate	29850876
Muscular Dystrophy Duchenne	Associate	35090586
Myelodysplastic Syndromes	Associate	24719867
Nasopharyngeal Carcinoma	Associate	29424902
Neoplasm Metastasis	Associate	24946933, 28099519, 32641980, 33451139
Neoplasm Metastasis	Stimulate	28422720
Neoplasm Metastasis	Inhibit	40634441
Neoplasms	Associate	21656576, 21915726, 23519121, 24714748, 24868315, 24946933, 27941881, 28099519, 28422720, 28574838, 28578276, 30523245, 32641980, 33499904, 34209278, 37392558 View all (1 more)
Neoplasms	Inhibit	28894215
Neoplasms	Stimulate	40634441
Nerve Degeneration	Inhibit	37081190
Neuroblastoma	Associate	29426376
Neurodegenerative Diseases	Associate	25645462, 37081190
Neuroinflammatory Diseases	Associate	29671417
Non Muscle Invasive Bladder Neoplasms	Stimulate	40362200
Obesity	Associate	30813866
Osteoarthritis	Associate	23840483, 32516132
Osteoarthritis	Stimulate	26521743
Osteoglophonic dwarfism	Associate	40289338
Ovarian Neoplasms	Associate	28578276, 34209278
Pancreatic Neoplasms	Associate	15155719, 21118808
Pancreatic Neoplasms	Stimulate	33499904
Parkinson Disease	Associate	25645462
Pre Eclampsia	Stimulate	26574162, 34298913
Precancerous Conditions	Associate	22032647
Primary Ovarian Insufficiency	Associate	35845923
Prostatic Neoplasms	Associate	26473288, 36891298
Prostatic Neoplasms	Stimulate	29441570
Prostatitis	Stimulate	28578276
Pulmonary Disease Chronic Obstructive	Associate	27435477, 29986678
Pulmonary Fibrosis	Associate	33325804
Retinal Diseases	Associate	38118351
Retinal Dysplasia	Associate	22032647
Retinitis	Associate	38118351
Scleroderma Systemic	Stimulate	31119153, 37246768
Squamous Cell Carcinoma of Head and Neck	Associate	24048704
Stomach Neoplasms	Associate	34983559, 35023280, 35938505
Thyroid Neoplasms	Associate	30367082
Urethral Neoplasms	Associate	22032647
Urinary Bladder Diseases	Stimulate	28578276
Urinary Bladder Neoplasms	Associate	21252614, 22032647
Vascular Diseases	Associate	24385682
Wounds and Injuries	Associate	36840500

NOX4 (NADPH oxidase 4)