Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs
Entrez ID	50507
Gene name	NADPH oxidase 4
Gene symbol	NOX4
Synonyms (NCBI Gene)	KOXKOX-1RENOX
Chromosome	11
Chromosome location	11q14.3
Summary	This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular

Show/Hide all (86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019477	hsa-miR-148b-3p	Microarray	17612493
MIRT437922	rno-miR-25-3p	Luciferase reporter assay	23722270
MIRT437922	rno-miR-25-3p	Luciferase reporter assay	23722270
MIRT756008	hsa-miR-99a-5p	Luciferase reporter assayqRT-PCRWestern blot	26986073
MIRT734718	hsa-miR-214-3p	Western blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	32051833
MIRT755591	hsa-miR-182-5p	Western blottingqRT-PCRImmunohistochemistry (IHC)ImmunofluorescenceELISA	37737899
MIRT756008	hsa-miR-99a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35135443
MIRT1190255	hsa-miR-34b	CLIP-seq
MIRT1190256	hsa-miR-34c-3p	CLIP-seq
MIRT1190257	hsa-miR-3545-3p	CLIP-seq
MIRT1190258	hsa-miR-4256	CLIP-seq
MIRT1190259	hsa-miR-4635	CLIP-seq
MIRT1190260	hsa-miR-4680-5p	CLIP-seq
MIRT1190261	hsa-miR-4714-5p	CLIP-seq
MIRT1190262	hsa-miR-548g	CLIP-seq
MIRT1190263	hsa-miR-640	CLIP-seq
MIRT1190257	hsa-miR-3545-3p	CLIP-seq
MIRT1190264	hsa-miR-3663-5p	CLIP-seq
MIRT1190258	hsa-miR-4256	CLIP-seq
MIRT1190265	hsa-miR-4273	CLIP-seq
MIRT1190266	hsa-miR-4303	CLIP-seq
MIRT1190267	hsa-miR-4517	CLIP-seq
MIRT1190259	hsa-miR-4635	CLIP-seq
MIRT1190268	hsa-miR-4677-5p	CLIP-seq
MIRT1190260	hsa-miR-4680-5p	CLIP-seq
MIRT1190261	hsa-miR-4714-5p	CLIP-seq
MIRT1190263	hsa-miR-640	CLIP-seq
MIRT1190269	hsa-miR-1271	CLIP-seq
MIRT1190270	hsa-miR-182	CLIP-seq
MIRT1190271	hsa-miR-3622a-5p	CLIP-seq
MIRT1190272	hsa-miR-375	CLIP-seq
MIRT1190273	hsa-miR-4258	CLIP-seq
MIRT1190274	hsa-miR-4423-3p	CLIP-seq
MIRT1190275	hsa-miR-4428	CLIP-seq
MIRT1190276	hsa-miR-4642	CLIP-seq
MIRT1190277	hsa-miR-4775	CLIP-seq
MIRT1190278	hsa-miR-498	CLIP-seq
MIRT1190279	hsa-miR-590-3p	CLIP-seq
MIRT1190280	hsa-miR-9	CLIP-seq
MIRT1190281	hsa-miR-96	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT1190275	hsa-miR-4428	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT2055110	hsa-miR-1237	CLIP-seq
MIRT2055111	hsa-miR-1248	CLIP-seq
MIRT2055112	hsa-miR-1303	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT2055113	hsa-miR-370	CLIP-seq
MIRT2055114	hsa-miR-3977	CLIP-seq
MIRT1190273	hsa-miR-4258	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT2284061	hsa-miR-935	CLIP-seq
MIRT2055110	hsa-miR-1237	CLIP-seq
MIRT2055111	hsa-miR-1248	CLIP-seq
MIRT2055112	hsa-miR-1303	CLIP-seq
MIRT2055113	hsa-miR-370	CLIP-seq
MIRT2055114	hsa-miR-3977	CLIP-seq
MIRT2439047	hsa-miR-129-5p	CLIP-seq
MIRT2439047	hsa-miR-129-5p	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq
MIRT1922287	hsa-miR-122	CLIP-seq
MIRT1922288	hsa-miR-24	CLIP-seq
MIRT1922289	hsa-miR-3135b	CLIP-seq
MIRT1922290	hsa-miR-3652	CLIP-seq
MIRT1922291	hsa-miR-4284	CLIP-seq
MIRT1922292	hsa-miR-4430	CLIP-seq
MIRT1922293	hsa-miR-4772-3p	CLIP-seq

Show/Hide all (7)

Transcription factor	Regulation	Reference
E2F1	Activation	18554521
NFKB1	Activation	20622120
RELA	Activation	20622120
SP3	Activation	21235713
STAT1	Unknown	19834108
STAT3	Unknown	19834108
STAT4	Unknown	19834108

Show/Hide all (72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	TAS	10869423
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000902	Process	Cell morphogenesis	ISS	10869423
GO:0003015	Process	Heart process	IEA
GO:0003015	Process	Heart process	IGI	27525436
GO:0005515	Function	Protein binding	IPI	15356101, 17064675
GO:0005634	Component	Nucleus	IDA	16324151, 23393389
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS	27525436
GO:0005730	Component	Nucleolus	IDA	23393389
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS	27525436
GO:0005783	Component	Endoplasmic reticulum	IDA	21343298
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	15927447
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16019190, 21343298
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IEA
GO:0006801	Process	Superoxide metabolic process	IDA	18760347
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0006952	Process	Defense response	IBA
GO:0006954	Process	Inflammatory response	TAS	10869423
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS	10869423
GO:0009055	Function	Electron transfer activity	TAS	10869423
GO:0010467	Process	Gene expression	IMP	23144758
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10869423
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IBA
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IDA	14966267, 15356101, 15927447, 25062272
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	IMP	21343298
GO:0016174	Function	NAD(P)H oxidase H2O2-forming activity	TAS	10869423
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IBA
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IDA	15721269
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IDA	10869423, 11032835, 15155719, 15721269, 15927447, 16019190, 16179589, 16230378, 16324151, 23393389, 25062272
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019826	Function	Oxygen sensor activity	TAS	10869423
GO:0020037	Function	Heme binding	IDA	25062272
GO:0020037	Function	Heme binding	TAS	10869423
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS	27525436
GO:0042554	Process	Superoxide anion generation	IBA
GO:0042554	Process	Superoxide anion generation	IEA
GO:0042554	Process	Superoxide anion generation	ISS	10869423
GO:0043020	Component	NADPH oxidase complex	IBA
GO:0045453	Process	Bone resorption	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15721269
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS	27525436
GO:0050660	Function	Flavin adenine dinucleotide binding	TAS	10869423
GO:0050667	Process	Homocysteine metabolic process	IDA	20031578
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0055007	Process	Cardiac muscle cell differentiation	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0072341	Function	Modified amino acid binding	IDA	20031578
GO:0072593	Process	Reactive oxygen species metabolic process	IEA
GO:0097038	Component	Perinuclear endoplasmic reticulum	ISS	27525436
GO:0106292	Function	Superoxide-generating NADPH oxidase activity	IEA
GO:1903409	Process	Reactive oxygen species biosynthetic process	NAS	27525436
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	ISS	27525436
GO:2000573	Process	Positive regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
605261	7891	ENSG00000086991

Q9NPH5

Protein name

NADPH oxidase 4 (EC 1.6.3.1) (Kidney oxidase-1) (KOX-1) (Kidney superoxide-producing NADPH oxidase) (Renal NAD(P)H-oxidase)

Protein function

NADPH oxidase that catalyzes predominantly the reduction of oxygen to H2O2 (PubMed:14966267, PubMed:15356101, PubMed:15927447, PubMed:21343298, PubMed:25062272). Can also catalyze to a smaller extent, the reduction of oxygen to superoxide (PubMe

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01794	Ferric_reduct	58 → 205	Ferric reductase like transmembrane component	Family
PF08022	FAD_binding_8	306 → 417	FAD-binding domain	Domain
PF08030	NAD_binding_6	423 → 561	Ferric reductase NAD binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by distal tubular cells in kidney cortex and in endothelial cells (at protein level). Widely expressed. Strongly expressed in kidney and to a lower extent in heart, adipocytes, hepatoma, endothelial cells, skeletal muscle, br

Sequence

MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS
ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV
AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY
AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP
EYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY
RYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP
TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH
NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK
TVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS

Sequence length

578

Interactions

View interactions

NOX4 (NADPH oxidase 4)