NOX1 (NADPH oxidase 1)

Gene

• Entrez ID: 27035
• Gene name: NADPH oxidase 1
• Gene symbol: NOX1
• Synonyms (NCBI Gene): GP91-2, MOX1, NOH-1, NOH-1L, NOH1
• Chromosome: X
• Chromosome location: Xq22.1
• Summary: This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been obs

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs142303829	G>A	Likely-benign, likely-pathogenic	Coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2284051	hsa-miR-3126-5p	CLIP-seq
MIRT2284052	hsa-miR-3151	CLIP-seq
MIRT2284053	hsa-miR-3689a-3p	CLIP-seq
MIRT2284054	hsa-miR-3689c	CLIP-seq
MIRT2284055	hsa-miR-4447	CLIP-seq
MIRT2284056	hsa-miR-4472	CLIP-seq
MIRT2284057	hsa-miR-4651	CLIP-seq
MIRT2284058	hsa-miR-4728-5p	CLIP-seq
MIRT2284059	hsa-miR-491-5p	CLIP-seq
MIRT2284060	hsa-miR-608	CLIP-seq
MIRT2391665	hsa-miR-106a	CLIP-seq
MIRT2391666	hsa-miR-106b	CLIP-seq
MIRT2391667	hsa-miR-134	CLIP-seq
MIRT2391668	hsa-miR-17	CLIP-seq
MIRT2391669	hsa-miR-20a	CLIP-seq
MIRT2391670	hsa-miR-20b	CLIP-seq
MIRT2391671	hsa-miR-3118	CLIP-seq
MIRT2391672	hsa-miR-3609	CLIP-seq
MIRT2391673	hsa-miR-371-5p	CLIP-seq
MIRT2391674	hsa-miR-4796-3p	CLIP-seq
MIRT2391675	hsa-miR-519d	CLIP-seq
MIRT2391676	hsa-miR-548ah	CLIP-seq
MIRT2391677	hsa-miR-767-3p	CLIP-seq
MIRT2391678	hsa-miR-93	CLIP-seq
MIRT2686445	hsa-miR-4714-5p	CLIP-seq
MIRT2686446	hsa-miR-568	CLIP-seq
MIRT2686447	hsa-miR-618	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HIPK2	Repression	20171273
STAT1	Unknown	19834108
STAT3	Unknown	19834108
STAT4	Unknown	19834108

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IMP	11805326
GO:0003081	Process	Regulation of systemic arterial blood pressure by renin-angiotensin	IEA
GO:0005244	Function	Voltage-gated ion channel activity	IEA
GO:0005515	Function	Protein binding	IPI	16636067, 32296183
GO:0005769	Component	Early endosome	IDA	17673675
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006739	Process	NADP metabolic process	IC	10485709
GO:0006952	Process	Defense response	IBA	21873635
GO:0006954	Process	Inflammatory response	TAS	18347018
GO:0007165	Process	Signal transduction	TAS	17673675
GO:0008217	Process	Regulation of blood pressure	TAS	18347018
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10485709
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IEP	11805326
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IBA	21873635
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IC	10485709
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	IMP	18023288
GO:0016175	Function	Superoxide-generating NAD(P)H oxidase activity	TAS	10485709, 18347018
GO:0016477	Process	Cell migration	IMP	18023288
GO:0030054	Component	Cell junction	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031267	Function	Small GTPase binding	IPI	16636067
GO:0034220	Process	Ion transmembrane transport	IEA
GO:0034765	Process	Regulation of ion transmembrane transport	IEA
GO:0042554	Process	Superoxide anion generation	IBA	21873635
GO:0042554	Process	Superoxide anion generation	IDA	10485709
GO:0042554	Process	Superoxide anion generation	IMP	18023288
GO:0042743	Process	Hydrogen peroxide metabolic process	IDA	11331784
GO:0043020	Component	NADPH oxidase complex	IBA	21873635
GO:0043020	Component	NADPH oxidase complex	IDA	16636067
GO:0045726	Process	Positive regulation of integrin biosynthetic process	IMP	18023288
GO:0045730	Process	Respiratory burst	TAS	16636067
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	ISS	10485709
GO:0050661	Function	NADP binding	IC	10485709
GO:0051454	Process	Intracellular pH elevation	IDA	10615049
GO:0071455	Process	Cellular response to hyperoxia	IEA
GO:0072592	Process	Oxygen metabolic process	IEA
GO:1902177	Process	Positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1990451	Process	Cellular stress response to acidic pH	IDA	10615049

Other IDs

• MIM: 300225
• HGNC: 7889
• e!Ensembl: ENSG00000007952

Protein

• UniProt ID: Q9Y5S8
• Protein name: NADPH oxidase 1 (NOX-1) (EC 1.6.3.-) (Mitogenic oxidase 1) (MOX-1) (NADH/NADPH mitogenic oxidase subunit P65-MOX) (NOH-1)
• Protein function: NADPH oxidase that catalyzes the generation of superoxide from molecular oxygen utilizing NADPH as an electron donor. ; FUNCTION
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01794	Ferric_reduct	54 → 219	Ferric reductase like transmembrane component	Family
  PF08022	FAD_binding_8	292 → 389	FAD-binding domain	Domain
  PF08030	NAD_binding_6	395 → 545	Ferric reductase NAD binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: [Isoform NOH-1L]: Detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. {ECO:0000269|PubMed:10485709, ECO:0000269|PubMed:10615049}.
• Sequence:

  MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
  NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
  FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
  MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
  RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
  VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
  WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
  FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
  IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
  RKCCHRYSSLDPRKVQFYFNKENF

• Sequence length: 564