Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	56954
Gene name Gene Name - the full gene name approved by the HGNC.	Nitrilase family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NIT2
Synonyms (NCBI Gene) Gene synonyms aliases	HEL-S-8a
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q12.2

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044603	hsa-miR-320a	CLASH	23622248
MIRT1185945	hsa-miR-3613-5p	CLIP-seq
MIRT1185946	hsa-miR-3674	CLIP-seq
MIRT1185947	hsa-miR-4778-5p	CLIP-seq
MIRT1185948	hsa-miR-4781-3p	CLIP-seq
MIRT2581348	hsa-miR-3160-5p	CLIP-seq
MIRT2581349	hsa-miR-3185	CLIP-seq
MIRT2581350	hsa-miR-3612	CLIP-seq
MIRT2581351	hsa-miR-3688-3p	CLIP-seq
MIRT2581352	hsa-miR-432	CLIP-seq
MIRT2581353	hsa-miR-4443	CLIP-seq
MIRT2581354	hsa-miR-4690-3p	CLIP-seq
MIRT2581355	hsa-miR-4719	CLIP-seq
MIRT2581356	hsa-miR-513b	CLIP-seq
MIRT2581357	hsa-miR-544	CLIP-seq
MIRT2581358	hsa-miR-650	CLIP-seq
MIRT2581359	hsa-miR-7	CLIP-seq
MIRT2581360	hsa-miR-767-3p	CLIP-seq
MIRT2581361	hsa-miR-891b	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006107	Process	Oxaloacetate metabolic process	IBA
GO:0006107	Process	Oxaloacetate metabolic process	IDA	22674578
GO:0006528	Process	Asparagine metabolic process	IBA
GO:0006528	Process	Asparagine metabolic process	IDA	22674578
GO:0006541	Process	Glutamine metabolic process	IBA
GO:0006541	Process	Glutamine metabolic process	IDA	22674578
GO:0016787	Function	Hydrolase activity	IEA
GO:0016811	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0050152	Function	Omega-amidase activity	IBA
GO:0050152	Function	Omega-amidase activity	IDA	22674578
GO:0050152	Function	Omega-amidase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0106008	Function	2-oxoglutaramate amidase activity	IEA
GO:1904724	Component	Tertiary granule lumen	TAS

MIM	HGNC	e!Ensembl
616769	29878	ENSG00000114021

Protein

UniProt ID

Q9NQR4

Protein name

Omega-amidase NIT2 (EC 3.5.1.3) (Nitrilase homolog 2)

Protein function

Has omega-amidase activity (PubMed:19595734, PubMed:22674578). The role of omega-amidase is to remove potentially toxic intermediates by converting 2-oxoglutaramate and 2-oxosuccinamate to biologically useful 2-oxoglutarate and oxaloacetate, res

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00795	CN_hydrolase	5 → 256	Carbon-nitrogen hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in fetal brain (at protein level). Ubiquitous. Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, prostate, spleen, thymus, prostate, testis, ovary, small intestine and colon. {ECO:0000269|PubM

Sequence

MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEK
IPGESTQKLSEVAKECSIYLIGGSIPEEDAGKLYNTCAVFGPDGTLLAKYRKIHLFDIDV
PGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYPGAFN
LTTGPAHWELLQRSRAVDNQVYVATASPARDDKASYVAWGHSTVVNPWGEVLAKAGTEEA
IVYSDIDLKKLAEIRQQIPVFRQKRSDLYAVEMKKP

Sequence length

276

Interactions

View interactions

NIT2 (nitrilase family member 2)