Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4794
Gene name Gene Name - the full gene name approved by the HGNC.
NFKB inhibitor epsilon
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NFKBIE
Synonyms (NCBI Gene) Gene synonyms aliases
IKBE
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene binds to components of NF-kappa-B, trapping the complex in the cytoplasm and preventing it from activating genes in the nucleus. Phosphorylation of the encoded protein targets it for destruction by the ubiquitin pathway, w
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029491 hsa-miR-26b-5p Microarray 19088304
MIRT036677 hsa-miR-935 CLASH 23622248
MIRT1183556 hsa-miR-1182 CLIP-seq
MIRT1183557 hsa-miR-1287 CLIP-seq
MIRT1183558 hsa-miR-3135b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001650 Component Fibrillar center IDA
GO:0005515 Function Protein binding IPI 14743216, 16769727, 21988832, 28514442, 33961781, 35271311, 37643469
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 9135156
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604548 7799 ENSG00000146232
Protein
UniProt ID O00221
Protein name NF-kappa-B inhibitor epsilon (NF-kappa-BIE) (I-kappa-B-epsilon) (IkB-E) (IkB-epsilon) (IkappaBepsilon)
Protein function Sequesters NF-kappa-B transcription factor complexes in the cytoplasm, thereby inhibiting their activity (PubMed:9315679). Sequestered complexes include NFKB1-RELA (p50-p65) and NFKB1-REL (p50-c-Rel) complexes (PubMed:9135156, PubMed:9315679). L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00023 Ank 403 434 Ankyrin repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Highly expressed in spleen, testis and lung, followed by kidney, pancreas, heart, placenta and brain. Also expressed in granulocytes and macrophages.
Sequence
MNQRRSESRPGNHRLQAYAEPGKGDSGGAGPLSGSARRGRGGGGAIRVRRPCWSGGAGRG
GGPAWAVRLPTVTAGWTWPALRTLSSLRAGPSEPHSPGRRPPRAGRPLCQADPQPGKAAR
RSLEPDPAQTGPRPARAAGMSEARKGPDEAEESQYDSGIESLRSLRSLPESTSAPASGPS
DGSPQPCTHPPGPVKEPQEKEDADGERADSTYGSSSLTYTLSLLGGPEAEDPAPRLPLPH
VGALSPQQLEALTYISEDGDTLVHLAVIHEAPAVLLCCLALLPQEVLDIQNNLYQTALHL
AVHLDQPGAVRALVLKGASRALQDRHGDTALHVACQRQHLACARCLLEGRPEPGRGTSHS
LDLQLQNWQGLACLHIATLQKNQPLMELLLRNGADIDVQEGTSGKTALHLAVETQERGLV
QFLLQAGAQVDARM
LNGCTPLHLAAGRGLMGISSTLCKAGADSLLRNVEDETPQDLTEES
LVLLPFDDLKISGKLLLCTD
Sequence length 500
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 23028356, 23577190, 26587663, 26686423
Graves Disease Associate 35720300
Hodgkin Disease Associate 27670424, 32079702
Inflammation Associate 28542447
Leukemia Lymphocytic Chronic B Cell Associate 22675518, 25987724, 27670424, 36566271
Lupus Erythematosus Systemic Associate 26686423
Lymphoma Associate 27670424
Lymphoma B Cell Associate 25987724, 27670424
Lymphoma Large B Cell Diffuse Associate 27670424, 36215154
Lymphoma Mantle Cell Associate 32961552