Gene Gene information from NCBI Gene database.
Entrez ID 4793
Gene name NFKB inhibitor beta
Gene symbol NFKBIB
Synonyms (NCBI Gene)
IKBBTRIP9
Chromosome 19
Chromosome location 19q13.2
Summary The protein encoded by this gene belongs to the NF-kappa-B inhibitor family, which inhibit NF-kappa-B by complexing with, and trapping it in the cytoplasm. Phosphorylation of serine residues on these proteins by kinases marks them for destruction via the
miRNA miRNA information provided by mirtarbase database.
226
miRTarBase ID miRNA Experiments Reference
MIRT731837 hsa-miR-20a-5p ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 26286834
MIRT731837 hsa-miR-20a-5p ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 26286834
MIRT1183525 hsa-miR-1 CLIP-seq
MIRT1183526 hsa-miR-206 CLIP-seq
MIRT1183527 hsa-miR-3064-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
SRY Unknown 12475944
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity TAS 7776974
GO:0005515 Function Protein binding IPI 10498867, 14685242, 14743216, 15601829, 21988832, 24973451, 25241761, 25416956, 32296183, 32814053, 33961781, 35140242, 35271311
GO:0005634 Component Nucleus IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604495 7798 ENSG00000104825
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15653
Protein name NF-kappa-B inhibitor beta (NF-kappa-BIB) (I-kappa-B-beta) (IkB-B) (IkB-beta) (IkappaBbeta) (Thyroid receptor-interacting protein 9) (TR-interacting protein 9) (TRIP-9)
Protein function Inhibits NF-kappa-B by complexing with and trapping it in the cytoplasm. However, the unphosphorylated form resynthesized after cell stimulation is able to bind NF-kappa-B allowing its transport to the nucleus and protecting it to further NFKBIA
PDB 9CK0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13637 Ank_4 58 113 Repeat
PF00023 Ank 126 151 Ankyrin repeat Repeat
PF13637 Ank_4 207 261 Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined.
Sequence
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKL
YAAGAGL
CVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALY
PDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC
GRSPLHLAVEAQAADVLELLL
RAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPE
PEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV
Sequence length 356
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Likely benign rs1471237670 RCV005929527
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Atherosclerosis Associate 28195197
Breast Neoplasms Associate 10373501
Carcinoma Hepatocellular Associate 33275223
Cystic Fibrosis Associate 12762338
Emphysema Stimulate 27104832
Hodgkin Disease Associate 34807923
Idiopathic Pulmonary Fibrosis Associate 27104832
Inflammation Associate 12762338, 24516231
Inflammatory Breast Neoplasms Associate 18248671
Neoplasms Associate 16147986