Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	25945
Gene name	Nectin cell adhesion molecule 3
Gene symbol	NECTIN3
Synonyms (NCBI Gene)	CD113CDW113NECTIN-3PPR3PRR3PVRL3PVRR3
Chromosome	3
Chromosome location	3q13.13
Summary	This gene encodes a member of the nectin family of proteins, which function as adhesion molecules at adherens junctions. This family member interacts with other nectin-like proteins and with afadin, a filamentous actin-binding protein involved in the regu

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs79006549	A>C,G	Likely-pathogenic	Coding sequence variant, missense variant, non coding transcript variant

Show/Hide all (26)

miRTarBase ID	miRNA	Experiments	Reference
MIRT450740	hsa-miR-548n	PAR-CLIP	22100165
MIRT450739	hsa-miR-548a-5p	PAR-CLIP	22100165
MIRT450738	hsa-miR-548ab	PAR-CLIP	22100165
MIRT450737	hsa-miR-548ad-5p	PAR-CLIP	22100165
MIRT450736	hsa-miR-548ae-5p	PAR-CLIP	22100165
MIRT450735	hsa-miR-548ak	PAR-CLIP	22100165
MIRT450734	hsa-miR-548am-5p	PAR-CLIP	22100165
MIRT450733	hsa-miR-548ap-5p	PAR-CLIP	22100165
MIRT450732	hsa-miR-548aq-5p	PAR-CLIP	22100165
MIRT450731	hsa-miR-548ar-5p	PAR-CLIP	22100165
MIRT450730	hsa-miR-548as-5p	PAR-CLIP	22100165
MIRT450729	hsa-miR-548au-5p	PAR-CLIP	22100165
MIRT450728	hsa-miR-548ay-5p	PAR-CLIP	22100165
MIRT450727	hsa-miR-548b-5p	PAR-CLIP	22100165
MIRT450726	hsa-miR-548bb-5p	PAR-CLIP	22100165
MIRT450725	hsa-miR-548c-5p	PAR-CLIP	22100165
MIRT450724	hsa-miR-548d-5p	PAR-CLIP	22100165
MIRT450723	hsa-miR-548h-5p	PAR-CLIP	22100165
MIRT450722	hsa-miR-548i	PAR-CLIP	22100165
MIRT450721	hsa-miR-548j-5p	PAR-CLIP	22100165
MIRT450720	hsa-miR-548o-5p	PAR-CLIP	22100165
MIRT450719	hsa-miR-548w	PAR-CLIP	22100165
MIRT450718	hsa-miR-548y	PAR-CLIP	22100165
MIRT450717	hsa-miR-559	PAR-CLIP	22100165
MIRT450716	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT450715	hsa-miR-3163	PAR-CLIP	22100165

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002089	Process	Lens morphogenesis in camera-type eye	IEA
GO:0005515	Function	Protein binding	IPI	19011627, 21982860, 22902367, 23758976, 25416956, 31515488, 32296183, 32814053, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	IEA
GO:0005911	Component	Cell-cell junction	ISS
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	ISS
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS
GO:0009566	Process	Fertilization	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	22902367
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043296	Component	Apical junction complex	IBA
GO:0043296	Component	Apical junction complex	IEA
GO:0044291	Component	Cell-cell contact zone	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0050839	Function	Cell adhesion molecule binding	IEA
GO:0050839	Function	Cell adhesion molecule binding	IPI	12438620
GO:0060042	Process	Retina morphogenesis in camera-type eye	IEA
GO:0061951	Process	Establishment of protein localization to plasma membrane	IEA
GO:0061951	Process	Establishment of protein localization to plasma membrane	ISS
GO:0070161	Component	Anchoring junction	IEA
GO:0090103	Process	Cochlea morphogenesis	IEA
GO:0090103	Process	Cochlea morphogenesis	ISS
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098631	Function	Cell adhesion mediator activity	IBA
GO:0098631	Function	Cell adhesion mediator activity	IEA
GO:0098631	Function	Cell adhesion mediator activity	ISS
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA
GO:1902414	Process	Protein localization to cell junction	IEA

MIM	HGNC	e!Ensembl
607147	17664	ENSG00000177707

Q9NQS3

Protein name

Nectin-3 (CDw113) (Nectin cell adhesion molecule 3) (Poliovirus receptor-related protein 3) (CD antigen CD113)

Protein function

Cell adhesion molecule that promotes cell-cell adhesion through heterophilic trans-interactions with nectins-like or other nectins, such as trans-interaction with NECTIN2 at Sertoli-spermatid junctions (PubMed:16216929). Trans-interaction with P

PDB

4FOM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	61 → 167	Immunoglobulin V-set domain	Domain
PF08205	C2-set_2	173 → 257	CD80-like C2-set immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in testis and placenta as well as in many cell lines, including epithelial cell lines. {ECO:0000269|PubMed:11024295}.

Sequence

MARTLRPSPLCPGGGKAQLSSASLLGAGLLLQPPTPPPLLLLLFPLLLFSRLCGALAGPI
IVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGR
VLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDS
LIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSFPNETATIISQYKLFPTRFAR
GRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPF
KSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQKVIYISDPPT
TTTLQPTIQWHPSTADIEDLATEPKKLPFPLSTLATIKDDTIATIIASVVGGALFIVLVS
VLAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQDELDSYPDSVKKENKNPVNN
LIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGS
VISRREWYV

Sequence length

549

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Developmental cataract	Conflicting classifications of pathogenicity	rs79006549	RCV000490767
NECTIN3-related disorder	Benign; Conflicting classifications of pathogenicity; Likely benign	rs3733174, rs139530035, rs79006549, rs145238359, rs193104048, rs150017735, rs146315231, rs375756370, rs143896077, rs369337016, rs144247865, rs146210788, rs200790665, rs199677974	RCV003921285 RCV003976020 RCV004757980 RCV003929850 RCV003903826 RCV003909731 RCV003909760 RCV003941848 RCV003907299 RCV003914644 RCV003956900 RCV003921992 RCV003934300 RCV003969045

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	30469078
Breast Neoplasms	Associate	24386110, 37643511
Calcinosis Cutis	Inhibit	24386110
Colorectal Neoplasms	Associate	26177744
Colorectal Neoplasms	Inhibit	37958883
Lymphatic Metastasis	Associate	18084611
Lymphatic Vessel Tumors	Associate	18084611
Nasopharyngeal Carcinoma	Associate	33038291
Neoplasm Metastasis	Associate	24386110, 26177744, 37958883
Neoplasms	Associate	26177744, 37244912
Neoplasms	Stimulate	30469078
Orofacial Cleft 1	Associate	26868259
Ovarian Neoplasms	Associate	30469078
Pancreatic Neoplasms	Associate	25690753, 30469078
Rhabdomyosarcoma	Associate	37244912
Severe Acute Respiratory Syndrome	Associate	28689229
ST Elevation Myocardial Infarction	Associate	26367242

NECTIN3 (nectin cell adhesion molecule 3)