Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
5819
Gene name Gene Name - the full gene name approved by the HGNC.
Nectin cell adhesion molecule 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NECTIN2
Synonyms (NCBI Gene) Gene synonyms aliases
CD112, HVEB, PRR2, PVRL2, PVRR2
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT439851 hsa-miR-218-5p HITS-CLIP 23212916
MIRT439851 hsa-miR-218-5p HITS-CLIP 23212916
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0001675 Process Acrosome assembly IBA
GO:0001675 Process Acrosome assembly IEA
GO:0002860 Process Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target IBA
GO:0002860 Process Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600798 9707 ENSG00000130202
Protein
UniProt ID Q92692
Protein name Nectin-2 (Herpes virus entry mediator B) (Herpesvirus entry mediator B) (HveB) (Nectin cell adhesion molecule 2) (Poliovirus receptor-related protein 2) (CD antigen CD112)
Protein function Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5,
PDB 3R0N , 4DFH , 4DFI , 4HZA , 5V52 , 8X6B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 37 159 Immunoglobulin V-set domain Domain
PF08205 C2-set_2 159 249 CD80-like C2-set immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPV
PGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAEL
QDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRV
IAKPKNQAEAQKVTFSQDPTTV
ALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKV
EHESFEEPA
LIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTS
GTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
IIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPV
PPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
Sequence length 538
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease, Alzheimer's disease or gastroesophageal reflux disease N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Cerebral amyloid angiopathy Cerebral amyloid angiopathy N/A N/A GWAS
Coronary Heart Disease Coronary heart disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 23330003
Adenocarcinoma of Lung Associate 34102454
Alzheimer Disease Associate 19442637, 22159054, 26543236, 27328823, 28650998, 29107063, 29739406, 31346172, 31755389, 32160291, 32709662, 34681041, 34752346, 36982982, 37108578
View all (3 more)
Ascites Associate 30843637
Breast Neoplasms Associate 24386110
Calcinosis Cutis Stimulate 24386110
Carcinogenesis Associate 36916296
Carcinoma Hepatocellular Associate 19404979, 22997493, 26936487
Carcinoma Pancreatic Ductal Associate 26294807
Carcinoma Squamous Cell Associate 23330003