Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10398
Gene name Gene Name - the full gene name approved by the HGNC.	Myosin light chain 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MYL9
Synonyms (NCBI Gene) Gene synonyms aliases	LC20, MLC-2C, MLC2, MMIHS4, MRLC1, MYRL2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MMIHS4
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded prot

Show/Hide all(108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437478	hsa-miR-663a	Luciferase reporter assay, qRT-PCR, Western blot	24014830
MIRT490441	hsa-miR-3936	PAR-CLIP	23592263
MIRT490442	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT490440	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT490439	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT490438	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT490437	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT490436	hsa-miR-3151-3p	PAR-CLIP	23592263
MIRT490435	hsa-miR-7515	PAR-CLIP	23592263
MIRT490434	hsa-miR-3179	PAR-CLIP	23592263
MIRT490433	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT490432	hsa-miR-3192-3p	PAR-CLIP	23592263
MIRT490431	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT731661	hsa-miR-223-3p	Luciferase reporter assay	27121304
MIRT731661	hsa-miR-223-3p	Luciferase reporter assay	27121304
MIRT490441	hsa-miR-3936	PAR-CLIP	23592263
MIRT490442	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT490440	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT490439	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT490438	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT490437	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT490436	hsa-miR-3151-3p	PAR-CLIP	23592263
MIRT490435	hsa-miR-7515	PAR-CLIP	23592263
MIRT490434	hsa-miR-3179	PAR-CLIP	23592263
MIRT490433	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT490432	hsa-miR-3192-3p	PAR-CLIP	23592263
MIRT490431	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT1168635	hsa-miR-1270	CLIP-seq
MIRT1168636	hsa-miR-147	CLIP-seq
MIRT1168637	hsa-miR-1913	CLIP-seq
MIRT1168638	hsa-miR-3192	CLIP-seq
MIRT1168639	hsa-miR-324-3p	CLIP-seq
MIRT1168640	hsa-miR-326	CLIP-seq
MIRT1168641	hsa-miR-330-5p	CLIP-seq
MIRT1168642	hsa-miR-33a	CLIP-seq
MIRT1168643	hsa-miR-33b	CLIP-seq
MIRT1168644	hsa-miR-3911	CLIP-seq
MIRT1168645	hsa-miR-4313	CLIP-seq
MIRT1168646	hsa-miR-4314	CLIP-seq
MIRT1168647	hsa-miR-4327	CLIP-seq
MIRT1168648	hsa-miR-4531	CLIP-seq
MIRT1168649	hsa-miR-4646-5p	CLIP-seq
MIRT1168650	hsa-miR-4683	CLIP-seq
MIRT1168651	hsa-miR-4710	CLIP-seq
MIRT1168652	hsa-miR-4727-5p	CLIP-seq
MIRT1168653	hsa-miR-4792	CLIP-seq
MIRT1168654	hsa-miR-599	CLIP-seq
MIRT1168655	hsa-miR-620	CLIP-seq
MIRT1168656	hsa-miR-644	CLIP-seq
MIRT2277401	hsa-miR-1236	CLIP-seq
MIRT2277402	hsa-miR-1343	CLIP-seq
MIRT2277403	hsa-miR-4691-5p	CLIP-seq
MIRT2277404	hsa-miR-4757-5p	CLIP-seq
MIRT2277405	hsa-miR-637	CLIP-seq
MIRT2277405	hsa-miR-637	CLIP-seq
MIRT1168636	hsa-miR-147	CLIP-seq
MIRT2431319	hsa-miR-3144-5p	CLIP-seq
MIRT1168642	hsa-miR-33a	CLIP-seq
MIRT1168643	hsa-miR-33b	CLIP-seq
MIRT2431320	hsa-miR-3649	CLIP-seq
MIRT1168644	hsa-miR-3911	CLIP-seq
MIRT1168647	hsa-miR-4327	CLIP-seq
MIRT1168651	hsa-miR-4710	CLIP-seq
MIRT1168653	hsa-miR-4792	CLIP-seq
MIRT1168654	hsa-miR-599	CLIP-seq
MIRT1168656	hsa-miR-644	CLIP-seq
MIRT1168636	hsa-miR-147	CLIP-seq
MIRT2431319	hsa-miR-3144-5p	CLIP-seq
MIRT2576295	hsa-miR-3151	CLIP-seq
MIRT1168642	hsa-miR-33a	CLIP-seq
MIRT1168643	hsa-miR-33b	CLIP-seq
MIRT2431320	hsa-miR-3649	CLIP-seq
MIRT1168644	hsa-miR-3911	CLIP-seq
MIRT1168647	hsa-miR-4327	CLIP-seq
MIRT2576296	hsa-miR-4447	CLIP-seq
MIRT2576297	hsa-miR-4450	CLIP-seq
MIRT2576298	hsa-miR-4472	CLIP-seq
MIRT1168651	hsa-miR-4710	CLIP-seq
MIRT1168653	hsa-miR-4792	CLIP-seq
MIRT2576299	hsa-miR-491-5p	CLIP-seq
MIRT1168654	hsa-miR-599	CLIP-seq
MIRT1168656	hsa-miR-644	CLIP-seq
MIRT2685644	hsa-miR-1207-5p	CLIP-seq
MIRT2685645	hsa-miR-125a-5p	CLIP-seq
MIRT2685646	hsa-miR-125b	CLIP-seq
MIRT1168636	hsa-miR-147	CLIP-seq
MIRT2431319	hsa-miR-3144-5p	CLIP-seq
MIRT2576295	hsa-miR-3151	CLIP-seq
MIRT1168642	hsa-miR-33a	CLIP-seq
MIRT1168643	hsa-miR-33b	CLIP-seq
MIRT2431320	hsa-miR-3649	CLIP-seq
MIRT1168644	hsa-miR-3911	CLIP-seq
MIRT2685647	hsa-miR-4319	CLIP-seq
MIRT1168647	hsa-miR-4327	CLIP-seq
MIRT2576296	hsa-miR-4447	CLIP-seq
MIRT2576297	hsa-miR-4450	CLIP-seq
MIRT2576298	hsa-miR-4472	CLIP-seq
MIRT2685648	hsa-miR-4525	CLIP-seq
MIRT1168651	hsa-miR-4710	CLIP-seq
MIRT2685649	hsa-miR-4713-3p	CLIP-seq
MIRT2685650	hsa-miR-4716-3p	CLIP-seq
MIRT2685651	hsa-miR-4732-3p	CLIP-seq
MIRT2685652	hsa-miR-4763-3p	CLIP-seq
MIRT1168653	hsa-miR-4792	CLIP-seq
MIRT2576299	hsa-miR-491-5p	CLIP-seq
MIRT1168654	hsa-miR-599	CLIP-seq
MIRT1168656	hsa-miR-644	CLIP-seq
MIRT2685653	hsa-miR-670	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
MAL	Unknown	19724058
RUNX1	Unknown	20876458;22898599
SRF	Unknown	19724058

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005859	Component	Muscle myosin complex	TAS	2526655
GO:0006936	Process	Muscle contraction	TAS
GO:0006937	Process	Regulation of muscle contraction	TAS	2526655
GO:0008307	Function	Structural constituent of muscle	TAS	2526655
GO:0030018	Component	Z disc	IEA
GO:0032036	Function	Myosin heavy chain binding	IEA
GO:0045652	Process	Regulation of megakaryocyte differentiation	TAS
GO:0070527	Process	Platelet aggregation	HMP	23382103

MIM	HGNC	e!Ensembl
609905	15754	ENSG00000101335

Protein

UniProt ID

P24844

Protein name

Myosin regulatory light polypeptide 9 (20 kDa myosin light chain) (LC20) (MLC-2C) (Myosin RLC) (Myosin regulatory light chain 2, smooth muscle isoform) (Myosin regulatory light chain 9) (Myosin regulatory light chain MRLC1)

Protein function

Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion (PubMed:11942626, PubMed

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13405	EF-hand_6	33 → 62	EF-hand domain	Domain
PF13833	EF-hand_8	114 → 166	EF-hand domain pair	Domain

Tissue specificity

TISSUE SPECIFICITY: Smooth muscle tissues and in some, but not all, nonmuscle cells. {ECO:0000269|PubMed:2526655}.

Sequence

MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

Sequence length

172

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Megacystis-Microcolon-Intestinal Hypoperistalsis Syndrome	megacystis-microcolon-intestinal hypoperistalsis syndrome 4			GenCC

Show/Hide Text Mining Associations (47)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Inhibit	34729929
Adrenocortical Carcinoma	Associate	34729929
Albuminuria	Associate	28805547
Aortic Aneurysm Abdominal	Associate	34852854
Blood Platelet Disorders	Associate	20876458
Breast Neoplasms	Associate	34729929, 34911847
Carcinoma Hepatocellular	Associate	34729929
Carcinoma Non Small Cell Lung	Associate	25179839
Carcinoma Non Small Cell Lung	Inhibit	39437553
Carcinoma Pancreatic Ductal	Associate	34821071
Carcinoma Squamous Cell	Inhibit	34729929
Cholangiocarcinoma	Associate	34729929
Colonic Neoplasms	Associate	34729929, 36910014
Colorectal Neoplasms	Associate	29246519, 30786729, 33096021, 37031206
Colorectal Neoplasms	Stimulate	34974798
Diabetes Mellitus	Associate	29955616
Edema	Associate	38013282
Esophageal Squamous Cell Carcinoma	Associate	28388691
Fetal Growth Retardation	Associate	40285515
Glaucoma Open Angle	Associate	24603425
Glioblastoma	Associate	35456975
Glioma	Associate	33885248
Glioma of Brain Familial	Associate	34729929
Hematologic Neoplasms	Associate	34729929
Hypertrophy Left Ventricular	Associate	29068603
Inflammation	Associate	38013282
Intracranial Aneurysm	Associate	24615040
Leukemia Myeloid Acute	Associate	22898599
Lung Neoplasms	Associate	30867848, 34729929, 34911847
Megacystis microcolon intestinal hypoperistalsis syndrome	Associate	29453416, 33031641
Melanoma	Associate	34911847
Necrosis	Associate	38013282
Neoplasm Metastasis	Associate	28388691, 34729929, 34821071, 34911847, 37031206, 37950670
Neoplasms	Associate	25179839, 28388691, 34729929, 34821071, 34911847, 38013282, 39437553
Neoplasms Squamous Cell	Stimulate	37950670
Ovarian Neoplasms	Associate	34729929
Platelet Disorder Familial with Associated Myeloid Malignancy	Associate	22898599
Pre Eclampsia	Inhibit	40285515
Prostatic Hyperplasia	Associate	37781794
Prostatic Neoplasms	Associate	34729929, 34911847, 37781794, 38179769
Smooth Muscle Tumor	Associate	33031641
Squamous Cell Carcinoma of Head and Neck	Associate	34729929
Stomach Neoplasms	Associate	31322220, 34729929
Thrombocytopenia	Associate	20876458
Turner Syndrome	Associate	32210915
Ureteral Obstruction	Associate	38013282
Urinary Bladder Neoplasms	Associate	38013282

MYL9 (myosin light chain 9)