MYL7 (myosin light chain 7)

Gene Gene information from NCBI Gene database.
Gene SNPs Transcription factors Other IDs
Entrez ID 58498
Gene name Myosin light chain 7
Gene symbol MYL7
Synonyms (NCBI Gene)
MYL2AMYLC2A
Chromosome 7
Chromosome location 7p13
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene SNPs Transcription factors Other IDs
Show/Hide all (1)
Transcription factor Regulation Reference
JARID2 Unknown 18805276
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
Gene SNPs Transcription factors Other IDs
Show/Hide all (14)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005829 Component Cytosol IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs Transcription factors Other IDs
MIM HGNC e!Ensembl
613993 21719 ENSG00000106631
Protein Protein information from UniProt database.
Gene SNPs Transcription factors Other IDs
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q01449
Protein name Myosin regulatory light chain 2, atrial isoform (MLC-2a) (MLC2a) (Myosin light chain 2a) (Myosin regulatory light chain 7)
Family and domains
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in adult atrial muscle. {ECO:0000269|PubMed:1429676}.
Sequence 
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
Sequence length 175
Interactions View interactions