MYL5 (myosin light chain 5)

Gene
Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4636
Gene name Gene Name - the full gene name approved by the HGNC.
Myosin light chain 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYL5
Synonyms (NCBI Gene) Gene synonyms aliases
MYLC2
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. Thi
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs Other IDs
Show/Hide all(6)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IEA
GO:0005829 Component Cytosol TAS
GO:0005859 Component Muscle myosin complex TAS 1284596
GO:0006936 Process Muscle contraction TAS
GO:0006937 Process Regulation of muscle contraction TAS 1284596
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs Other IDs
MIM HGNC e!Ensembl
160782 7586 ENSG00000215375
Protein
Gene SNPs Other IDs
UniProt ID Q02045
Protein name Myosin light chain 5 (Myosin regulatory light chain 5) (Superfast myosin regulatory light chain 2) (MYLC2) (MyLC-2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 34 → 62 EF hand Domain
PF13202 EF-hand_5 106 → 129 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal skeletal muscle and retina.
Sequence 
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Sequence length 173
Interactions View interactions