MYL5 (myosin light chain 5)

Gene Gene information from NCBI Gene database.
Gene SNPs Other IDs
Entrez ID 4636
Gene name Myosin light chain 5
Gene symbol MYL5
Synonyms (NCBI Gene)
MYLC2
Chromosome 4
Chromosome location 4p16.3
Summary This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. Thi
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene SNPs Other IDs
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005737 Component Cytoplasm IBA
GO:0005829 Component Cytosol IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs Other IDs
MIM HGNC e!Ensembl
160782 7586 ENSG00000215375
Protein Protein information from UniProt database.
Gene SNPs Other IDs
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q02045
Protein name Myosin light chain 5 (Myosin regulatory light chain 5) (Superfast myosin regulatory light chain 2) (MYLC2) (MyLC-2)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 34 → 62 EF hand Domain
PF13202 EF-hand_5 106 → 129 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal skeletal muscle and retina.
Sequence 
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Sequence length 173
Interactions View interactions