Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4634
Gene name Gene Name - the full gene name approved by the HGNC.
Myosin light chain 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYL3
Synonyms (NCBI Gene) Gene synonyms aliases
CMH8, MLC-lV/sb, MLC1SB, MLC1V, VLC1, VLCl
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypert
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104893748 T>C Pathogenic Missense variant, coding sequence variant
rs104893749 C>A,T Pathogenic, likely-pathogenic, uncertain-significance Missense variant, coding sequence variant
rs104893750 C>T Conflicting-interpretations-of-pathogenicity, pathogenic, pathogenic-likely-pathogenic, likely-pathogenic, uncertain-significance Missense variant, coding sequence variant
rs139794067 G>A,C,T Pathogenic, uncertain-significance, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs145520567 C>T Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002026 Process Regulation of the force of heart contraction IMP 16675844
GO:0003774 Function Cytoskeletal motor activity IEA
GO:0003785 Function Actin monomer binding IDA 16675844
GO:0005509 Function Calcium ion binding IEA
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
160790 7584 ENSG00000160808
Protein
UniProt ID P08590
Protein name Myosin light chain 3 (Cardiac myosin light chain 1) (CMLC1) (Myosin light chain 1, slow-twitch muscle B/ventricular isoform) (MLC1SB) (Ventricular myosin alkali light chain) (Ventricular myosin light chain 1) (VLCl) (Ventricular/slow twitch myosin alkali
Protein function Regulatory light chain of myosin. Does not bind calcium.
PDB 5TBY , 8ACT , 8G4L
Family and domains
Sequence
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFML
FDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQH
ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSN
GCINYEAFVKHIMSS
Sequence length 195
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
cardiomyopathy Cardiomyopathy rs199474703 N/A
Hypertrophic cardiomyopathy hypertrophic cardiomyopathy rs199474703, rs730880162, rs104893748 N/A
Hypertrophic Cardiomyopathy Hypertrophic cardiomyopathy 8, Primary familial hypertrophic cardiomyopathy rs199474703, rs104893748 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Diabetes Type 2 diabetes mellitus or coronary artery disease (pleiotropy) N/A N/A GWAS
Long QT Syndrome long qt syndrome N/A N/A ClinVar
Myopathy dilated cardiomyopathy N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Apical Hypertrophic Cardiomyopathy Associate 35288424
Atrial Fibrillation Associate 20641121
Cardiomyopathies Associate 22194935, 35544052, 37477868
Cardiomyopathy Dilated Associate 26458567
Cardiomyopathy Familial Hypertrophic 1 Associate 26443374
Cardiomyopathy Hypertrophic Associate 16199542, 20641121, 21896538, 25086479, 25342278, 26443374, 27483260, 28771489, 29914921, 30681346, 35288424, 37431535, 37466024, 37477868, 39340495
Cardiomyopathy Hypertrophic Familial Associate 22112859, 35288424
Cardiomyopathy Restrictive Associate 21823217
Colorectal Neoplasms Associate 9748578
Death Sudden Cardiac Associate 35288424