Gene Gene information from NCBI Gene database.
Entrez ID 4634
Gene name Myosin light chain 3
Gene symbol MYL3
Synonyms (NCBI Gene)
CMH8MLC-lV/sbMLC1SBMLC1VVLC1VLCl
Chromosome 3
Chromosome location 3p21.31
Summary MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypert
SNPs SNP information provided by dbSNP.
20
SNP ID Visualize variation Clinical significance Consequence
rs104893748 T>C Pathogenic Missense variant, coding sequence variant
rs104893749 C>A,T Pathogenic, likely-pathogenic, uncertain-significance Missense variant, coding sequence variant
rs104893750 C>T Conflicting-interpretations-of-pathogenicity, pathogenic, pathogenic-likely-pathogenic, likely-pathogenic, uncertain-significance Missense variant, coding sequence variant
rs139794067 G>A,C,T Pathogenic, uncertain-significance, conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs145520567 C>T Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0002026 Process Regulation of the force of heart contraction IMP 16675844
GO:0003774 Function Cytoskeletal motor activity IEA
GO:0003785 Function Actin monomer binding IDA 16675844
GO:0005509 Function Calcium ion binding IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
160790 7584 ENSG00000160808
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P08590
Protein name Myosin light chain 3 (Cardiac myosin light chain 1) (CMLC1) (Myosin light chain 1, slow-twitch muscle B/ventricular isoform) (MLC1SB) (Ventricular myosin alkali light chain) (Ventricular myosin light chain 1) (VLCl) (Ventricular/slow twitch myosin alkali
Protein function Regulatory light chain of myosin. Does not bind calcium.
PDB 5TBY , 8ACT , 8G4L
Family and domains
Sequence
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFML
FDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQH
ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSN
GCINYEAFVKHIMSS
Sequence length 195
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
718
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cardiomyopathy Likely pathogenic; Pathogenic rs199474703 RCV000769168
Cardiovascular phenotype Likely pathogenic; Pathogenic rs104893748, rs199474703 RCV004018632
RCV003162261
Hypertrophic cardiomyopathy Likely pathogenic; Pathogenic rs730880162, rs104893748, rs199474703 RCV003447508
RCV000168418
RCV000824445
Hypertrophic cardiomyopathy 8 Likely pathogenic; Pathogenic rs104893748, rs199474703 RCV000015105
RCV000491596
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Amyloidosis, hereditary systemic 1 Conflicting classifications of pathogenicity rs199639940 RCV000852967
Cardiomyopathy, familial restrictive, 1 Uncertain significance rs104893749 RCV000491772
Dilated cardiomyopathy 1U Conflicting classifications of pathogenicity rs1282347222 RCV005860310
Hypertrophic cardiomyopathy 1 Uncertain significance rs377026344 RCV001256743
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Apical Hypertrophic Cardiomyopathy Associate 35288424
Atrial Fibrillation Associate 20641121
Cardiomyopathies Associate 22194935, 35544052, 37477868
Cardiomyopathy Dilated Associate 26458567
Cardiomyopathy Familial Hypertrophic 1 Associate 26443374
Cardiomyopathy Hypertrophic Associate 16199542, 20641121, 21896538, 25086479, 25342278, 26443374, 27483260, 28771489, 29914921, 30681346, 35288424, 37431535, 37466024, 37477868, 39340495
Cardiomyopathy Hypertrophic Familial Associate 22112859, 35288424
Cardiomyopathy Restrictive Associate 21823217
Colorectal Neoplasms Associate 9748578
Death Sudden Cardiac Associate 35288424