Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
4633
Gene name Gene Name - the full gene name approved by the HGNC.
Myosin light chain 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MYL2
Synonyms (NCBI Gene) Gene synonyms aliases
CMH10, MFM12, MLC-2, MLC-2s/v, MLC-2v, MLC2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CMH10, MFM12
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q24.11
Summary Summary of gene provided in NCBI Entrez Gene.
Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventr
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894363 C>T Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity, benign, likely-pathogenic Coding sequence variant, missense variant
rs104894368 C>A,G,T Pathogenic-likely-pathogenic, pathogenic, uncertain-significance Coding sequence variant, stop gained, missense variant
rs104894369 C>A,T Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs104894370 A>G Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs111373423 A>G Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT048671 hsa-miR-99a-5p CLASH 23622248
MIRT736741 hsa-miR-124-3p qRT-PCR 32727232
MIRT1168601 hsa-miR-3675-5p CLIP-seq
MIRT1168602 hsa-miR-4691-3p CLIP-seq
MIRT1168603 hsa-miR-4694-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002026 Process Regulation of the force of heart contraction ISS
GO:0003785 Function Actin monomer binding IDA 9180271
GO:0005509 Function Calcium ion binding IDA 11102452
GO:0005515 Function Protein binding IPI 11773029, 16555005, 32296183
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
160781 7583 ENSG00000111245
Protein
UniProt ID P10916
Protein name Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MLC-2) (MLC-2v) (Cardiac myosin light chain 2) (Myosin light chain 2, slow skeletal/ventricular muscle isoform) (MLC-2s/v) (Ventricular myosin light chain 2)
Protein function Contractile protein that plays a role in heart development and function (PubMed:23365102, PubMed:32453731). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm st
PDB 5TBY , 8ACT , 8G4L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 28 56 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in type I muscle fibers. {ECO:0000269|PubMed:23365102, ECO:0000269|PubMed:32453731}.
Sequence
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Sequence length 166
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Hypertrophic cardiomyopathy hypertrophic cardiomyopathy 10, hypertrophic cardiomyopathy GenCC
Myopathy myopathy, myofibrillar, 12, infantile-onset, with cardiomyopathy, dilated cardiomyopathy GenCC
Ventricular Cardiomyopathy arrhythmogenic right ventricular cardiomyopathy GenCC
Congenital myopathy with fiber type disproportion congenital fiber-type disproportion myopathy GenCC
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 18948272
Cardiomyopathies Associate 22194935, 31127036, 35544052, 37967257
Cardiomyopathy Dilated Stimulate 11812662
Cardiomyopathy Dilated Associate 30690923
Cardiomyopathy Dilated with Left Ventricular Noncompaction Associate 30690923
Cardiomyopathy Hypertrophic Associate 16199542, 18411228, 21259275, 21896538, 22429680, 22857948, 25086479, 25342278, 27483260, 27841901, 28223422, 28771489, 29709087, 30681346, 30775854
View all (4 more)
Cardiomyopathy Hypertrophic Familial Associate 22112859
Cardiomyopathy Restrictive Associate 21823217
Chagas Disease Associate 22543060
Colorectal Neoplasms Associate 30846413