Gene Gene information from NCBI Gene database.
Entrez ID 4633
Gene name Myosin light chain 2
Gene symbol MYL2
Synonyms (NCBI Gene)
CMH10MFM12MLC-2MLC-2s/vMLC-2vMLC2
Chromosome 12
Chromosome location 12q24.11
Summary Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventr
SNPs SNP information provided by dbSNP.
31
SNP ID Visualize variation Clinical significance Consequence
rs104894363 C>T Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity, benign, likely-pathogenic Coding sequence variant, missense variant
rs104894368 C>A,G,T Pathogenic-likely-pathogenic, pathogenic, uncertain-significance Coding sequence variant, stop gained, missense variant
rs104894369 C>A,T Likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs104894370 A>G Pathogenic, likely-pathogenic Coding sequence variant, missense variant
rs111373423 A>G Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
8
miRTarBase ID miRNA Experiments Reference
MIRT048671 hsa-miR-99a-5p CLASH 23622248
MIRT736741 hsa-miR-124-3p qRT-PCR 32727232
MIRT1168601 hsa-miR-3675-5p CLIP-seq
MIRT1168602 hsa-miR-4691-3p CLIP-seq
MIRT1168603 hsa-miR-4694-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
45
GO ID Ontology Definition Evidence Reference
GO:0002026 Process Regulation of the force of heart contraction ISS
GO:0003007 Process Heart morphogenesis IEA
GO:0003785 Function Actin monomer binding IDA 9180271
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 11102452
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
160781 7583 ENSG00000111245
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P10916
Protein name Myosin regulatory light chain 2, ventricular/cardiac muscle isoform (MLC-2) (MLC-2v) (Cardiac myosin light chain 2) (Myosin light chain 2, slow skeletal/ventricular muscle isoform) (MLC-2s/v) (Ventricular myosin light chain 2)
Protein function Contractile protein that plays a role in heart development and function (PubMed:23365102, PubMed:32453731). Following phosphorylation, plays a role in cross-bridge cycling kinetics and cardiac muscle contraction by increasing myosin lever arm st
PDB 5TBY , 8ACT , 8G4L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 28 56 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in type I muscle fibers. {ECO:0000269|PubMed:23365102, ECO:0000269|PubMed:32453731}.
Sequence
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
Sequence length 166
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
991
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cardiomyopathy Likely pathogenic; Pathogenic rs397516398, rs104894368, rs104894369, rs104894370, rs397516406, rs1592798444 RCV001799463
RCV001170438
RCV001798005
RCV005401284
RCV003486556
RCV000770388
Cardiovascular phenotype Likely pathogenic; Pathogenic rs104894368, rs104894369, rs104894370, rs199474815 RCV002354163
RCV000621867
RCV000246859
RCV005403722
Congenital heart disease Pathogenic rs2136767620 RCV001568358
Congenital myopathy with fiber type disproportion Likely pathogenic rs2071647433 RCV001507318
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Arrhythmogenic right ventricular cardiomyopathy Uncertain significance rs199567559 RCV000852437
Cardiomyopathy, dilated, and heart failure Uncertain significance rs727504341 RCV005430503
Congestive heart failure Benign rs2301610, rs3833910, rs12301951 RCV003125836
RCV003125837
RCV003125848
Death in infancy Conflicting classifications of pathogenicity rs199474808 RCV000234981
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 18948272
Cardiomyopathies Associate 22194935, 31127036, 35544052, 37967257
Cardiomyopathy Dilated Stimulate 11812662
Cardiomyopathy Dilated Associate 30690923
Cardiomyopathy Dilated with Left Ventricular Noncompaction Associate 30690923
Cardiomyopathy Hypertrophic Associate 16199542, 18411228, 21259275, 21896538, 22429680, 22857948, 25086479, 25342278, 27483260, 27841901, 28223422, 28771489, 29709087, 30681346, 30775854
View all (4 more)
Cardiomyopathy Hypertrophic Familial Associate 22112859
Cardiomyopathy Restrictive Associate 21823217
Chagas Disease Associate 22543060
Colorectal Neoplasms Associate 30846413