MYL10 (myosin light chain 10)

Gene Gene information from NCBI Gene database.
Gene SNPs Other IDs
Entrez ID 93408
Gene name Myosin light chain 10
Gene symbol MYL10
Synonyms (NCBI Gene)
MYLC2PLPLRLC
Chromosome 7
Chromosome location 7q22.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene SNPs Other IDs
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005737 Component Cytoplasm IBA
GO:0005739 Component Mitochondrion IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs Other IDs
MIM HGNC e!Ensembl
617177 29825 ENSG00000106436
Protein Protein information from UniProt database.
Gene SNPs Other IDs
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BUA6
Protein name Myosin regulatory light chain 10 (Myosin light chain 2, lymphocyte-specific) (Precursor lymphocyte-specific regulatory light chain)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13833 EF-hand_8 93 → 134 EF-hand domain pair Domain
Sequence 
MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLA
LSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRIN
VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIK
EKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
Sequence length 226
Interactions View interactions