Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	23417
Gene name Gene Name - the full gene name approved by the HGNC.	Malonyl-CoA decarboxylase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MLYCD
Synonyms (NCBI Gene) Gene synonyms aliases	MCD
Disease Acronyms (UniProt) Disease acronyms from UniProt database	MCD
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The product of this gene catalyzes the breakdown of malonyl-CoA to acetyl-CoA and carbon dioxide. Malonyl-CoA is an intermediate in fatty acid biosynthesis, and also inhibits the transport of fatty acyl CoAs into mitochondria. Consequently, the encoded pr

Show/Hide all(13)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28937908	T>C	Pathogenic	Missense variant, coding sequence variant
rs104894528	C>G	Pathogenic	Coding sequence variant, stop gained
rs121908081	G>A	Pathogenic	Coding sequence variant, missense variant
rs138675420	G>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Synonymous variant, coding sequence variant, missense variant
rs201973830	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs374073138	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs398124254	->TGAAGC	Pathogenic	Coding sequence variant, inframe insertion
rs761146008	A>G	Pathogenic	Intron variant
rs796051991	G>-	Pathogenic, uncertain-significance	Coding sequence variant, frameshift variant
rs962135951	C>A,T	Pathogenic	Coding sequence variant, stop gained, missense variant
rs1064794623	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1294168838	GAGT>-	Pathogenic	Splice donor variant, coding sequence variant
rs1567636915	TT>-	Pathogenic	Coding sequence variant, frameshift variant

Show/Hide all(81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017783	hsa-miR-335-5p	Microarray	18185580
MIRT1152672	hsa-miR-1200	CLIP-seq
MIRT1152673	hsa-miR-1203	CLIP-seq
MIRT1152674	hsa-miR-1228	CLIP-seq
MIRT1152675	hsa-miR-1273e	CLIP-seq
MIRT1152676	hsa-miR-1304	CLIP-seq
MIRT1152677	hsa-miR-140-3p	CLIP-seq
MIRT1152678	hsa-miR-1915	CLIP-seq
MIRT1152679	hsa-miR-19a	CLIP-seq
MIRT1152680	hsa-miR-19b	CLIP-seq
MIRT1152681	hsa-miR-2116	CLIP-seq
MIRT1152682	hsa-miR-2467-3p	CLIP-seq
MIRT1152683	hsa-miR-3119	CLIP-seq
MIRT1152684	hsa-miR-3126-5p	CLIP-seq
MIRT1152685	hsa-miR-3140-5p	CLIP-seq
MIRT1152686	hsa-miR-320a	CLIP-seq
MIRT1152687	hsa-miR-320b	CLIP-seq
MIRT1152688	hsa-miR-320c	CLIP-seq
MIRT1152689	hsa-miR-320d	CLIP-seq
MIRT1152690	hsa-miR-329	CLIP-seq
MIRT1152691	hsa-miR-3611	CLIP-seq
MIRT1152692	hsa-miR-362-3p	CLIP-seq
MIRT1152693	hsa-miR-3977	CLIP-seq
MIRT1152694	hsa-miR-3978	CLIP-seq
MIRT1152695	hsa-miR-431	CLIP-seq
MIRT1152696	hsa-miR-4318	CLIP-seq
MIRT1152697	hsa-miR-4325	CLIP-seq
MIRT1152698	hsa-miR-4419a	CLIP-seq
MIRT1152699	hsa-miR-4429	CLIP-seq
MIRT1152700	hsa-miR-4510	CLIP-seq
MIRT1152701	hsa-miR-4670-3p	CLIP-seq
MIRT1152702	hsa-miR-4677-5p	CLIP-seq
MIRT1152703	hsa-miR-4693-5p	CLIP-seq
MIRT1152704	hsa-miR-4699-5p	CLIP-seq
MIRT1152705	hsa-miR-4710	CLIP-seq
MIRT1152706	hsa-miR-4719	CLIP-seq
MIRT1152707	hsa-miR-4734	CLIP-seq
MIRT1152708	hsa-miR-485-5p	CLIP-seq
MIRT1152709	hsa-miR-516a-3p	CLIP-seq
MIRT1152710	hsa-miR-604	CLIP-seq
MIRT1152711	hsa-miR-892a	CLIP-seq
MIRT1152673	hsa-miR-1203	CLIP-seq
MIRT2043627	hsa-miR-129-3p	CLIP-seq
MIRT2043628	hsa-miR-1972	CLIP-seq
MIRT2043629	hsa-miR-2355-3p	CLIP-seq
MIRT2043630	hsa-miR-3120-3p	CLIP-seq
MIRT2043631	hsa-miR-33a	CLIP-seq
MIRT2043632	hsa-miR-33b	CLIP-seq
MIRT2043633	hsa-miR-4270	CLIP-seq
MIRT2043634	hsa-miR-4280	CLIP-seq
MIRT2043635	hsa-miR-4441	CLIP-seq
MIRT2043636	hsa-miR-4646-3p	CLIP-seq
MIRT2043637	hsa-miR-4646-5p	CLIP-seq
MIRT1152705	hsa-miR-4710	CLIP-seq
MIRT2043638	hsa-miR-4747-5p	CLIP-seq
MIRT2043639	hsa-miR-4755-3p	CLIP-seq
MIRT2043640	hsa-miR-4792	CLIP-seq
MIRT2043641	hsa-miR-642a	CLIP-seq
MIRT2043642	hsa-miR-891a	CLIP-seq
MIRT2273061	hsa-miR-1207-5p	CLIP-seq
MIRT2273062	hsa-miR-1226	CLIP-seq
MIRT1152674	hsa-miR-1228	CLIP-seq
MIRT1152677	hsa-miR-140-3p	CLIP-seq
MIRT1152679	hsa-miR-19a	CLIP-seq
MIRT1152680	hsa-miR-19b	CLIP-seq
MIRT1152682	hsa-miR-2467-3p	CLIP-seq
MIRT2273063	hsa-miR-29a	CLIP-seq
MIRT2273064	hsa-miR-29b	CLIP-seq
MIRT2273065	hsa-miR-29c	CLIP-seq
MIRT2273066	hsa-miR-3065-3p	CLIP-seq
MIRT1152690	hsa-miR-329	CLIP-seq
MIRT1152692	hsa-miR-362-3p	CLIP-seq
MIRT2273067	hsa-miR-3941	CLIP-seq
MIRT2043633	hsa-miR-4270	CLIP-seq
MIRT2043635	hsa-miR-4441	CLIP-seq
MIRT1152706	hsa-miR-4719	CLIP-seq
MIRT2273068	hsa-miR-4729	CLIP-seq
MIRT2273069	hsa-miR-4763-3p	CLIP-seq
MIRT2273070	hsa-miR-485-3p	CLIP-seq
MIRT1152708	hsa-miR-485-5p	CLIP-seq
MIRT2273071	hsa-miR-603	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
PPARA	Unknown	16434556
PPARGC1A	Unknown	16434556

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002931	Process	Response to ischemia	ISS
GO:0005737	Component	Cytoplasm	IDA	10455107
GO:0005739	Component	Mitochondrion	IDA	10417274
GO:0005759	Component	Mitochondrial matrix	IBA	21873635
GO:0005759	Component	Mitochondrial matrix	ISS
GO:0005777	Component	Peroxisome	IDA	10417274, 10455107
GO:0005782	Component	Peroxisomal matrix	IBA	21873635
GO:0005782	Component	Peroxisomal matrix	ISS
GO:0005782	Component	Peroxisomal matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006085	Process	Acetyl-CoA biosynthetic process	IBA	21873635
GO:0006085	Process	Acetyl-CoA biosynthetic process	IDA	9869665, 10417274, 10455107
GO:0006085	Process	Acetyl-CoA biosynthetic process	IEA
GO:0006625	Process	Protein targeting to peroxisome	TAS
GO:0006633	Process	Fatty acid biosynthetic process	IDA	15003260
GO:0006637	Process	Acyl-CoA metabolic process	TAS
GO:0010906	Process	Regulation of glucose metabolic process	IMP	18314420
GO:0019395	Process	Fatty acid oxidation	IEA
GO:0031998	Process	Regulation of fatty acid beta-oxidation	IEA
GO:0042802	Function	Identical protein binding	IPI	23791943
GO:0046321	Process	Positive regulation of fatty acid oxidation	IBA	21873635
GO:0046321	Process	Positive regulation of fatty acid oxidation	IMP	18314420
GO:0050080	Function	Malonyl-CoA decarboxylase activity	IBA	21873635
GO:0050080	Function	Malonyl-CoA decarboxylase activity	IDA	9869665, 10417274, 10455107, 15003260
GO:0050080	Function	Malonyl-CoA decarboxylase activity	TAS
GO:2001294	Process	Malonyl-CoA catabolic process	IBA	21873635
GO:2001294	Process	Malonyl-CoA catabolic process	IDA	10417274, 10455107, 15003260

MIM	HGNC	e!Ensembl
606761	7150	ENSG00000103150

Protein

UniProt ID

O95822

Protein name

Malonyl-CoA decarboxylase, mitochondrial (MCD) (EC 4.1.1.9)

Protein function

Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acid

PDB

2YGW , 4F0X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17408	MCD_N	95 → 190	Malonyl-CoA decarboxylase N-terminal domain	Domain
PF05292	MCD	193 → 457	Malonyl-CoA decarboxylase C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fibroblasts and hepatoblastoma cells (at protein level). Expressed strongly in heart, liver, skeletal muscle, kidney and pancreas. Expressed in myotubes. Expressed weakly in brain, placenta, spleen, thymus, testis, ovary a

Sequence

MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKT
PAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAA
VLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNG
VLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFF
SHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQG
VELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSEC
KEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVA
NFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQV
LSLVAQFQKNSKL

Sequence length

493

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Neuroblastoma	Neuroblastoma	Loss of SNAI2 function reduces self-renewal, 3D invasion as well as metastatic spread in vivo, while strongly sensitizing neuroblastoma cells to RA-induced growth inhibition.	GWAS, CBGDA
Diabetes	Diabetes		GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Aortic Valve Disease	Associate	27250500
Carcinoma Renal Cell	Inhibit	37729394
Death Sudden Cardiac	Associate	22661490
Malonic aciduria	Associate	32602666, 34884438, 8259873
Malonic aciduria	Inhibit	34884438
Mitral Valve Insufficiency	Associate	27250500
Neoplasms	Inhibit	37729394
Osteosarcoma	Associate	37976137
Retinoblastoma	Associate	37603355

MLYCD (malonyl-CoA decarboxylase)