Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5595
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPK3
Synonyms (NCBI Gene) Gene synonyms aliases	ERK-1, ERK1, ERT2, HS44KDAP, HUMKER1A, P44ERK1, P44MAPK, PRKM3, p44-ERK1, p44-MAPK
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, a

Show/Hide all(199)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22465663
MIRT047369	hsa-miR-34a-5p	CLASH	23622248
MIRT042561	hsa-miR-423-3p	CLASH	23622248
MIRT036229	hsa-miR-320b	CLASH	23622248
MIRT732137	hsa-miR-550a-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27462780
MIRT732137	hsa-miR-550a-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27462780
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	25622783
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	25622783
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	25622783
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	25622783
MIRT006217	hsa-miR-483-5p	Western blotting, qRT-PCR	33915734
MIRT734389	hsa-miR-497-5p	qRT-PCR	34185228
MIRT734895	hsa-miR-362-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33459949
MIRT006217	hsa-miR-483-5p	Luciferase reporter assay, Microarray, qRT-PCR	22465663
MIRT734389	hsa-miR-497-5p	qRT-PCR	34185228
MIRT1130862	hsa-miR-1207-5p	CLIP-seq
MIRT1130863	hsa-miR-125a-5p	CLIP-seq
MIRT1130864	hsa-miR-125b	CLIP-seq
MIRT1130865	hsa-miR-1273f	CLIP-seq
MIRT1130866	hsa-miR-128	CLIP-seq
MIRT1130867	hsa-miR-1285	CLIP-seq
MIRT1130868	hsa-miR-1291	CLIP-seq
MIRT1130869	hsa-miR-132	CLIP-seq
MIRT1130870	hsa-miR-1321	CLIP-seq
MIRT1130871	hsa-miR-143	CLIP-seq
MIRT1130872	hsa-miR-15a	CLIP-seq
MIRT1130873	hsa-miR-15b	CLIP-seq
MIRT1130874	hsa-miR-16	CLIP-seq
MIRT1130875	hsa-miR-1827	CLIP-seq
MIRT1130876	hsa-miR-1908	CLIP-seq
MIRT1130877	hsa-miR-1909	CLIP-seq
MIRT1130878	hsa-miR-1913	CLIP-seq
MIRT1130879	hsa-miR-195	CLIP-seq
MIRT1130880	hsa-miR-205	CLIP-seq
MIRT1130881	hsa-miR-2110	CLIP-seq
MIRT1130882	hsa-miR-2114	CLIP-seq
MIRT1130883	hsa-miR-212	CLIP-seq
MIRT1130884	hsa-miR-3127-5p	CLIP-seq
MIRT1130885	hsa-miR-3162-3p	CLIP-seq
MIRT1130886	hsa-miR-3170	CLIP-seq
MIRT1130887	hsa-miR-3180-5p	CLIP-seq
MIRT1130888	hsa-miR-3184	CLIP-seq
MIRT1130889	hsa-miR-3187-5p	CLIP-seq
MIRT1130890	hsa-miR-324-3p	CLIP-seq
MIRT1130891	hsa-miR-328	CLIP-seq
MIRT1130892	hsa-miR-3612	CLIP-seq
MIRT1130893	hsa-miR-3622b-5p	CLIP-seq
MIRT1130894	hsa-miR-3689d	CLIP-seq
MIRT1130895	hsa-miR-423-5p	CLIP-seq
MIRT1130896	hsa-miR-424	CLIP-seq
MIRT1130897	hsa-miR-4263	CLIP-seq
MIRT1130898	hsa-miR-4270	CLIP-seq
MIRT1130899	hsa-miR-4271	CLIP-seq
MIRT1130900	hsa-miR-4319	CLIP-seq
MIRT1130901	hsa-miR-4326	CLIP-seq
MIRT1130902	hsa-miR-4441	CLIP-seq
MIRT1130903	hsa-miR-4459	CLIP-seq
MIRT1130904	hsa-miR-4463	CLIP-seq
MIRT1130905	hsa-miR-4492	CLIP-seq
MIRT1130906	hsa-miR-4498	CLIP-seq
MIRT1130907	hsa-miR-4505	CLIP-seq
MIRT1130908	hsa-miR-4514	CLIP-seq
MIRT1130909	hsa-miR-4667-5p	CLIP-seq
MIRT1130910	hsa-miR-4688	CLIP-seq
MIRT1130911	hsa-miR-4692	CLIP-seq
MIRT1130912	hsa-miR-4695-5p	CLIP-seq
MIRT1130913	hsa-miR-4700-5p	CLIP-seq
MIRT1130914	hsa-miR-4708-5p	CLIP-seq
MIRT1130915	hsa-miR-4722-5p	CLIP-seq
MIRT1130916	hsa-miR-4725-3p	CLIP-seq
MIRT1130917	hsa-miR-4731-5p	CLIP-seq
MIRT1130918	hsa-miR-4736	CLIP-seq
MIRT1130919	hsa-miR-4739	CLIP-seq
MIRT1130920	hsa-miR-4747-5p	CLIP-seq
MIRT1130921	hsa-miR-4756-5p	CLIP-seq
MIRT1130922	hsa-miR-4763-3p	CLIP-seq
MIRT1130923	hsa-miR-4770	CLIP-seq
MIRT1130924	hsa-miR-486-3p	CLIP-seq
MIRT1130925	hsa-miR-497	CLIP-seq
MIRT1130926	hsa-miR-503	CLIP-seq
MIRT1130927	hsa-miR-510	CLIP-seq
MIRT1130928	hsa-miR-512-5p	CLIP-seq
MIRT1130929	hsa-miR-520a-5p	CLIP-seq
MIRT1130930	hsa-miR-525-5p	CLIP-seq
MIRT1130931	hsa-miR-548ag	CLIP-seq
MIRT1130932	hsa-miR-548ai	CLIP-seq
MIRT1130933	hsa-miR-576-5p	CLIP-seq
MIRT1130934	hsa-miR-612	CLIP-seq
MIRT1130935	hsa-miR-622	CLIP-seq
MIRT1130936	hsa-miR-650	CLIP-seq
MIRT1130937	hsa-miR-656	CLIP-seq
MIRT1130938	hsa-miR-663	CLIP-seq
MIRT1130939	hsa-miR-762	CLIP-seq
MIRT1130940	hsa-miR-938	CLIP-seq
MIRT1130941	hsa-miR-940	CLIP-seq
MIRT2037338	hsa-miR-1	CLIP-seq
MIRT1130862	hsa-miR-1207-5p	CLIP-seq
MIRT1130866	hsa-miR-128	CLIP-seq
MIRT1130867	hsa-miR-1285	CLIP-seq
MIRT1130869	hsa-miR-132	CLIP-seq
MIRT1130870	hsa-miR-1321	CLIP-seq
MIRT2037339	hsa-miR-1587	CLIP-seq
MIRT1130872	hsa-miR-15a	CLIP-seq
MIRT1130873	hsa-miR-15b	CLIP-seq
MIRT1130874	hsa-miR-16	CLIP-seq
MIRT1130875	hsa-miR-1827	CLIP-seq
MIRT1130876	hsa-miR-1908	CLIP-seq
MIRT1130877	hsa-miR-1909	CLIP-seq
MIRT2037340	hsa-miR-1915	CLIP-seq
MIRT1130879	hsa-miR-195	CLIP-seq
MIRT1130880	hsa-miR-205	CLIP-seq
MIRT2037341	hsa-miR-206	CLIP-seq
MIRT1130883	hsa-miR-212	CLIP-seq
MIRT1130884	hsa-miR-3127-5p	CLIP-seq
MIRT1130888	hsa-miR-3184	CLIP-seq
MIRT1130889	hsa-miR-3187-5p	CLIP-seq
MIRT2037342	hsa-miR-3545-3p	CLIP-seq
MIRT1130892	hsa-miR-3612	CLIP-seq
MIRT2037343	hsa-miR-3672	CLIP-seq
MIRT2037344	hsa-miR-3675-3p	CLIP-seq
MIRT2037345	hsa-miR-378g	CLIP-seq
MIRT1130895	hsa-miR-423-5p	CLIP-seq
MIRT1130896	hsa-miR-424	CLIP-seq
MIRT1130897	hsa-miR-4263	CLIP-seq
MIRT1130898	hsa-miR-4270	CLIP-seq
MIRT1130901	hsa-miR-4326	CLIP-seq
MIRT1130902	hsa-miR-4441	CLIP-seq
MIRT1130903	hsa-miR-4459	CLIP-seq
MIRT2037346	hsa-miR-4480	CLIP-seq
MIRT1130905	hsa-miR-4492	CLIP-seq
MIRT1130906	hsa-miR-4498	CLIP-seq
MIRT1130907	hsa-miR-4505	CLIP-seq
MIRT1130908	hsa-miR-4514	CLIP-seq
MIRT2037347	hsa-miR-4521	CLIP-seq
MIRT2037348	hsa-miR-4645-5p	CLIP-seq
MIRT2037349	hsa-miR-4656	CLIP-seq
MIRT2037350	hsa-miR-4673	CLIP-seq
MIRT2037351	hsa-miR-4675	CLIP-seq
MIRT1130910	hsa-miR-4688	CLIP-seq
MIRT1130911	hsa-miR-4692	CLIP-seq
MIRT1130912	hsa-miR-4695-5p	CLIP-seq
MIRT1130915	hsa-miR-4722-5p	CLIP-seq
MIRT1130918	hsa-miR-4736	CLIP-seq
MIRT1130919	hsa-miR-4739	CLIP-seq
MIRT2037352	hsa-miR-4741	CLIP-seq
MIRT1130921	hsa-miR-4756-5p	CLIP-seq
MIRT1130922	hsa-miR-4763-3p	CLIP-seq
MIRT1130924	hsa-miR-486-3p	CLIP-seq
MIRT1130925	hsa-miR-497	CLIP-seq
MIRT1130926	hsa-miR-503	CLIP-seq
MIRT1130933	hsa-miR-576-5p	CLIP-seq
MIRT1130934	hsa-miR-612	CLIP-seq
MIRT2037353	hsa-miR-613	CLIP-seq
MIRT1130935	hsa-miR-622	CLIP-seq
MIRT2037354	hsa-miR-642b	CLIP-seq
MIRT1130936	hsa-miR-650	CLIP-seq
MIRT1130937	hsa-miR-656	CLIP-seq
MIRT1130938	hsa-miR-663	CLIP-seq
MIRT1130939	hsa-miR-762	CLIP-seq
MIRT1130941	hsa-miR-940	CLIP-seq
MIRT1130863	hsa-miR-125a-5p	CLIP-seq
MIRT1130864	hsa-miR-125b	CLIP-seq
MIRT1130868	hsa-miR-1291	CLIP-seq
MIRT1130875	hsa-miR-1827	CLIP-seq
MIRT2037340	hsa-miR-1915	CLIP-seq
MIRT2267262	hsa-miR-2467-3p	CLIP-seq
MIRT1130891	hsa-miR-328	CLIP-seq
MIRT1130892	hsa-miR-3612	CLIP-seq
MIRT2267263	hsa-miR-3678-3p	CLIP-seq
MIRT1130900	hsa-miR-4319	CLIP-seq
MIRT1130903	hsa-miR-4459	CLIP-seq
MIRT2037348	hsa-miR-4645-5p	CLIP-seq
MIRT2037350	hsa-miR-4673	CLIP-seq
MIRT1130912	hsa-miR-4695-5p	CLIP-seq
MIRT1130915	hsa-miR-4722-5p	CLIP-seq
MIRT1130918	hsa-miR-4736	CLIP-seq
MIRT2267264	hsa-miR-4756-3p	CLIP-seq
MIRT1130924	hsa-miR-486-3p	CLIP-seq
MIRT1130936	hsa-miR-650	CLIP-seq
MIRT2267265	hsa-miR-654-3p	CLIP-seq
MIRT1130941	hsa-miR-940	CLIP-seq
MIRT1130872	hsa-miR-15a	CLIP-seq
MIRT1130873	hsa-miR-15b	CLIP-seq
MIRT1130874	hsa-miR-16	CLIP-seq
MIRT1130879	hsa-miR-195	CLIP-seq
MIRT1130887	hsa-miR-3180-5p	CLIP-seq
MIRT1130896	hsa-miR-424	CLIP-seq
MIRT1130925	hsa-miR-497	CLIP-seq
MIRT1130926	hsa-miR-503	CLIP-seq
MIRT1130929	hsa-miR-520a-5p	CLIP-seq
MIRT1130930	hsa-miR-525-5p	CLIP-seq
MIRT1130887	hsa-miR-3180-5p	CLIP-seq
MIRT1130929	hsa-miR-520a-5p	CLIP-seq
MIRT1130930	hsa-miR-525-5p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
TWIST1	Activation	23222305

Show/Hide all(103)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	NAS	20018936
GO:0000165	Process	MAPK cascade	TAS
GO:0000186	Process	Activation of MAPKK activity	TAS
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IMP	19664780
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	18391015
GO:0004707	Function	MAP kinase activity	IBA	21873635
GO:0004707	Function	MAP kinase activity	IDA	8388392
GO:0004707	Function	MAP kinase activity	NAS	7687743
GO:0004708	Function	MAP kinase kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	10066421, 10419510, 10617468, 10747973, 11238443, 12840032, 15616583, 15950189, 16291755, 18794356, 19167335, 19197339, 19494114, 19564905, 20347885, 20622900, 21900206, 22307056, 23397142, 23452857, 23602568, 24606918, 24722188, 24825908, 25066297, 25241761, 25852190, 26496610, 319
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	TAS	19565474
GO:0005635	Component	Nuclear envelope	IDA	20455999
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	TAS	19565474
GO:0005769	Component	Early endosome	TAS	19565474
GO:0005770	Component	Late endosome	TAS	19565474
GO:0005794	Component	Golgi apparatus	TAS	19565474
GO:0005829	Component	Cytosol	TAS	19565474
GO:0005856	Component	Cytoskeleton	TAS	19565474
GO:0005886	Component	Plasma membrane	ISS
GO:0005901	Component	Caveola	ISS
GO:0005901	Component	Caveola	TAS	19565474
GO:0005925	Component	Focal adhesion	TAS	19565474
GO:0006361	Process	Transcription initiation from RNA polymerase I promoter	TAS
GO:0006468	Process	Protein phosphorylation	IDA	7687743
GO:0006915	Process	Apoptotic process	IEA
GO:0006975	Process	DNA damage induced protein phosphorylation	IDA	17560175
GO:0007049	Process	Cell cycle	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0007411	Process	Axon guidance	TAS
GO:0007568	Process	Aging	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	TAS
GO:0009636	Process	Response to toxic substance	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	24136195
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IGI	26754294
GO:0014066	Process	Regulation of phosphatidylinositol 3-kinase signaling	TAS
GO:0016032	Process	Viral process	IEA
GO:0016310	Process	Phosphorylation	IDA	15950189
GO:0018105	Process	Peptidyl-serine phosphorylation	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019369	Process	Arachidonic acid metabolic process	IEA
GO:0019902	Function	Phosphatase binding	IPI	19494114
GO:0030168	Process	Platelet activation	TAS
GO:0030278	Process	Regulation of ossification	IEA
GO:0030509	Process	BMP signaling pathway	IMP	19664780
GO:0030641	Process	Regulation of cellular pH	IEA
GO:0030878	Process	Thyroid gland development	IEA
GO:0031143	Component	Pseudopodium	IEA
GO:0031281	Process	Positive regulation of cyclase activity	IMP	22027397
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	21531765
GO:0032872	Process	Regulation of stress-activated MAPK cascade	TAS	19565474
GO:0032991	Component	Protein-containing complex	IEA
GO:0033129	Process	Positive regulation of histone phosphorylation	IMP	20018936
GO:0034198	Process	Cellular response to amino acid starvation	IDA	11096076
GO:0034614	Process	Cellular response to reactive oxygen species	IMP	26514923
GO:0035066	Process	Positive regulation of histone acetylation	IMP	20018936
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0038083	Process	Peptidyl-tyrosine autophosphorylation	IDA	8388392
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0042473	Process	Outer ear morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IPI	16627622, 22307056
GO:0043330	Process	Response to exogenous dsRNA	IEA
GO:0045727	Process	Positive regulation of translation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	20018936
GO:0046697	Process	Decidualization	IEA
GO:0048538	Process	Thymus development	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	TAS
GO:0051216	Process	Cartilage development	IEA
GO:0051403	Process	Stress-activated MAPK cascade	IDA	11096076
GO:0051493	Process	Regulation of cytoskeleton organization	TAS	19565474
GO:0051973	Process	Positive regulation of telomerase activity	IMP	21531765
GO:0060020	Process	Bergmann glial cell differentiation	IEA
GO:0060324	Process	Face development	IEA
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060440	Process	Trachea formation	IEA
GO:0061308	Process	Cardiac neural crest cell development involved in heart development	IEA
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0070371	Process	ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	19664780
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	20018936
GO:0070849	Process	Response to epidermal growth factor	IDA	18794356, 21968647
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0071276	Process	Cellular response to cadmium ion	IMP	26514923
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0072584	Process	Caveolin-mediated endocytosis	TAS	19565474
GO:0090170	Process	Regulation of Golgi inheritance	TAS	19565474
GO:0097110	Function	Scaffold protein binding	IEA
GO:0120041	Process	Positive regulation of macrophage proliferation	IGI	26754294
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1903351	Process	Cellular response to dopamine	IMP	24136195
GO:1904355	Process	Positive regulation of telomere capping	IMP	21531765
GO:1904417	Process	Positive regulation of xenophagy	IEA
GO:2000641	Process	Regulation of early endosome to late endosome transport	TAS	19565474
GO:2000657	Process	Negative regulation of apolipoprotein binding	IEA

MIM	HGNC	e!Ensembl
601795	6877	ENSG00000102882

Protein

UniProt ID

P27361

Protein name

Mitogen-activated protein kinase 3 (MAP kinase 3) (MAPK 3) (EC 2.7.11.24) (ERT2) (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase isoform p44) (p44-MAPK) (Microtubule-associated protein 2 kinase) (p44-ERK1)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:34497368). MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also i

PDB

2ZOQ , 4QTB , 6GES

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	42 → 330	Protein kinase domain	Domain

Sequence

MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGVLEAP

Sequence length

379

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Multiple Sclerosis	Multiple Sclerosis	GWAS
Dental caries	Dental caries	GWAS
Insomnia	Insomnia	GWAS
Atrial Fibrillation	Atrial Fibrillation	GWAS

Show/Hide Text Mining Associations (299)

Disease Name	Relationship Type	References
Associations from Text Mining
Abnormalities Drug Induced	Associate	35966064
Acrocephalosyndactylia	Associate	23404329
Acute Coronary Syndrome	Associate	25997853, 34239024
Acute Disease	Associate	17351113
Adenoameloblastoma	Associate	30643167
Adenocarcinoma	Associate	19445727
Adenocarcinoma Follicular	Associate	35464760
Adenocarcinoma of Lung	Associate	11891209, 17201164, 24374773, 25763322, 26556867, 33001583, 33426073, 35421944, 35929837, 35948545, 36613552, 36922519, 37000102, 37011005
Adrenocortical Carcinoma	Associate	35500219
Alzheimer Disease	Associate	19233276, 33915734, 37406134, 40533815
Alzheimer Disease 15	Associate	33915734
Anemia Aplastic	Stimulate	36334505
Aneurysm	Associate	34185228
Angina Unstable	Associate	34239024
Angiofibroma	Associate	28707818
Aortic Aneurysm Abdominal	Associate	23558220
Aortic Aneurysm Thoracic	Associate	25767191
Apical Hypertrophic Cardiomyopathy	Associate	36345035
Arteriovenous Malformations	Associate	32703450
Arthritis Rheumatoid	Associate	12937131, 18416822, 20185962, 24643522, 30915733, 38272919
Ascites	Stimulate	23158473
Asthma	Associate	31266368, 36675122, 37336194
Atherosclerosis	Associate	35202001
Atrial Fibrillation	Stimulate	10807475
Atrial Fibrillation	Associate	33706714
Atrophy	Associate	22518834
Autism Spectrum Disorder	Associate	35665681, 36401485
Autistic Disorder	Associate	21848643
Autoimmune Diseases	Associate	29339359
Barrett Esophagus	Associate	22744336
Bicuspid Aortic Valve Disease	Associate	37108591
Brain Ischemia	Associate	25418580
Breast Neoplasms	Associate	11960991, 15280923, 15603589, 15928662, 17392272, 17897439, 18225535, 19833733, 20112503, 20551949, 20554528, 20837468, 20889557, 20920193, 21643005 View all (35 more)
Calcinosis	Associate	35808901
Carcinogenesis	Associate	18166657, 18823380, 21076047, 24788939, 25120769, 25550802, 26701206, 29049217, 30577849, 34185141, 34497368
Carcinoid Tumor	Associate	20407018, 22965070
Carcinoma	Associate	19457236, 21960346
Carcinoma Acinar Cell	Associate	25763322
Carcinoma Adenoid Cystic	Associate	17591960, 25885343
Carcinoma Ductal	Associate	29215790
Carcinoma Ductal Breast	Associate	23083134
Carcinoma Hepatocellular	Associate	20930381, 22930530, 23112878, 25115442, 25514221, 27092498, 27468214, 28058860, 28375585, 28492136, 29377347, 31257493, 32398965, 32557953, 32977498 View all (15 more)
Carcinoma Intraductal Noninfiltrating	Associate	18166657, 19457236
Carcinoma Mucoepidermoid	Associate	12937136
Carcinoma Non Small Cell Lung	Associate	14997206, 19305165, 20008839, 21086091, 23291718, 23959478, 24108744, 25596700, 25598321, 25738359, 25948105, 26046675, 26104294, 26931433, 26985856 View all (18 more)
Carcinoma Pancreatic Ductal	Associate	22160930, 26880586, 28720574, 30803373, 35699794
Carcinoma Renal Cell	Stimulate	11731569
Carcinoma Renal Cell	Associate	18787400, 21947243, 24334253, 30048489, 31097685, 32009115, 32377748, 32547313, 36374334, 37373509, 37445722
Carcinoma Small Cell	Stimulate	27456359
Carcinoma Squamous Cell	Associate	11520272, 15160999, 20103886, 21960346, 25280968, 31049937, 31053522, 36922519, 37347115
Carcinoma Squamous Cell	Stimulate	28438789
Cardiofaciocutaneous syndrome	Associate	29158583
Cardiomyopathies	Associate	28256566
Cardiomyopathy Hypertrophic	Associate	20155832
Cell Transformation Neoplastic	Associate	24086649, 32055849, 35464760
Cerebral Infarction	Associate	33778069, 35140708, 38013375
Chemical and Drug Induced Liver Injury	Associate	24682220
Cholangiocarcinoma	Associate	17294242, 25815516, 29235470, 30305612
Cholestasis	Associate	35196362
Chondrosarcoma	Associate	24472657
Chordoma	Associate	25755752
Cognition Disorders	Associate	36961195
Colitis Ulcerative	Associate	34733451, 39328405
Colonic Neoplasms	Associate	16886596, 31366902
Colorectal Neoplasms	Inhibit	10323886
Colorectal Neoplasms	Associate	10993892, 14564515, 15078890, 17385215, 17848589, 18805444, 19017493, 19290007, 19372556, 19686845, 19930715, 20164542, 20413844, 20808308, 21826244 View all (39 more)
Congenital Disorders of Glycosylation	Associate	35211808
Constriction Pathologic	Associate	19751734
COVID 19	Associate	33452734, 34712201, 35855804, 36052061, 36817449, 37084641, 37347115
Crohn Disease	Associate	26636514
Cystic Fibrosis	Associate	20952496, 25134464, 33050003
Dermatitis Atopic	Associate	34678092
Diabetes Gestational	Associate	28400911, 34912302
Diabetes Mellitus	Associate	36623448
Diabetes Mellitus Type 2	Associate	19581418, 23110196, 26269521, 28934129, 35712257, 36937538
Diabetic Retinopathy	Associate	35574010
Disease	Associate	19298651, 24788939
Disease Resistance	Associate	30353128
Dissociative Disorders	Associate	23951008
Drug Related Side Effects and Adverse Reactions	Associate	20107314, 22342995, 26046675, 26340617, 28988120, 30194076, 30475204, 30572643, 35082402, 35228393, 36060138
Dyskinesia Drug Induced	Associate	12421823
Dyslipidemias	Associate	35899893
Ehlers Danlos syndrome progeroid form	Stimulate	15210734
Endometrial Neoplasms	Associate	17388789, 19154413, 21408143, 21720253, 24811094, 24817931, 26033187, 27542208, 29081408, 30445932, 31452406, 34174908, 34712201
Endometriosis	Associate	19589865, 24133578, 28333195
Eosinophilic Esophagitis	Associate	36591238
Epidermolysis Bullosa Simplex	Associate	34643242
Epilepsy Familial Mesial Temporal Lobe	Associate	37126322
Epilepsy Idiopathic Generalized	Inhibit	26537625
Esophageal Neoplasms	Associate	22938416, 25550802, 25730371, 30758105, 36555705
Esophageal Squamous Cell Carcinoma	Associate	19164283, 24966948, 25915860, 29620226, 33311557, 36813090, 36848349
Familial dermographism	Associate	32222457
Familial Hypophosphatemic Rickets	Associate	25420019
Familial Primary Pulmonary Hypertension	Associate	21037114
Fatigue Syndrome Chronic	Associate	27098723
Fetal Growth Retardation	Associate	34995552
Fibrocartilaginous embolism	Associate	21337395, 35437455
Fibrosarcoma	Associate	33109619
Fibrosis	Associate	10807475, 16202218, 26088859, 27385084
Gallbladder Diseases	Associate	19445727
Gallbladder Neoplasms	Associate	34118139
Gastrointestinal Neoplasms	Associate	25333257
Gastrointestinal Stromal Tumors	Associate	27469332
Glioblastoma	Associate	20201406, 20392929, 20823154, 22497886, 24587385, 25793261, 28341744, 28797294, 31467175, 32055849, 32926734, 35121903, 35807435, 37258577
Glioma	Associate	16563234, 18239851, 18281515, 20461251, 22211103, 22465663, 23652300, 23865743, 24489888, 28484053, 28620155, 29286066, 32753475
Glioma	Stimulate	30225541
Glomerulonephritis IGA	Associate	25782674
Glomerulonephritis Membranous	Associate	36588134
Glucosephosphate Dehydrogenase Deficiency	Associate	26366417
Graft vs Host Disease	Associate	36727399
Granulosa Cell Tumor	Associate	23322721
Graves Ophthalmopathy	Associate	33658982
HAIR AN syndrome	Associate	23110196
Heart Failure	Inhibit	17885560
Heart Failure Systolic	Associate	36303443
HELLP Syndrome	Associate	25583406
Hemangiopericytoma	Associate	31201369
Hematologic Neoplasms	Associate	17351113
Hereditary Angioedema Type III	Associate	29339359
Histiocytoma Malignant Fibrous	Associate	24676456
HIV Infections	Associate	21937661, 24910430, 25536401, 31260499
Holoprosencephaly Ectrodactyly and Bilateral Cleft Lip Palate	Associate	30787447
Huntington Disease	Associate	26011179
Hyperglycemia	Associate	22162761, 26010611, 27606810, 31150695
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	25878490
Hyperoxia	Stimulate	34911614
Hyperpigmentation	Associate	28382689
Hypertrophy	Associate	16920889
Hypothalamic hamartomas	Associate	25307426
Hypoxia	Stimulate	15220111, 15987743, 26785721, 34200497
Hypoxia	Associate	17099219, 17387271, 25166211, 25411969, 25583406, 26572277, 27486656, 30778913, 32206064
Hypoxia Brain	Inhibit	38129425
Idiopathic Pulmonary Fibrosis	Associate	17331965, 26138239, 30810067, 34831059
Immunologic Deficiency Syndromes	Stimulate	33545156
Inclusion Body Myopathy With Early Onset Paget Disease And Frontotemporal Dementia	Associate	31091164
Infections	Associate	16051824, 18276593, 20674951, 23797008, 27671041, 28944873, 34863201
Infections	Stimulate	24550731
Inflammation	Associate	16489115, 18276593, 18424438, 18653246, 18772336, 19858308, 21084287, 21937661, 23110196, 23856194, 24521217, 25308753, 25834404, 25963228, 26053099 View all (18 more)
Inflammatory Bowel Diseases	Associate	26636514
Inflammatory Breast Neoplasms	Associate	22295107, 23468988
Insulin Resistance	Associate	32651353
Intervertebral Disc Degeneration	Associate	27635110, 33251629, 34805401
Intrahepatic Cholestasis of Pregnancy	Associate	35643225
Ischemia	Stimulate	10807874
Ischemia	Associate	22848708, 26742633
Ischemia	Inhibit	25583406
Keloid	Associate	25369801
Kidney Failure Chronic	Associate	30212930
Kidney Neoplasms	Associate	21330408, 31002126, 31672701, 37047552
Leiomyoma	Associate	18853184
Leprosy	Associate	15967991
Leukemia	Associate	15860672, 19298651, 19773546, 22016818, 29917183
Leukemia Biphenotypic Acute	Associate	25313141
Leukemia Erythroblastic Acute	Associate	31545282
Leukemia Lymphocytic Chronic B Cell	Associate	11023495, 17890452, 18292287, 20661426, 22086413, 26919095, 27059597, 28982149, 33097837, 36847709, 37646669
Leukemia Lymphoma Adult T Cell	Associate	28785594, 34995552, 37832654
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	19363496, 29207054, 36195570
Leukemia Myeloid	Associate	29917183
Leukemia Myeloid Acute	Associate	11238126, 11698483, 16446383, 18931459, 20810927, 23474756, 27417454, 29207054, 30651113, 32102969, 36509141, 39273530
Leukemia Promyelocytic Acute	Associate	20164150, 29917183
Leukemia T Cell	Associate	29550383
Leukocytosis	Associate	20164150
Lipomatosis Multiple Symmetrical	Associate	33114687
Liposarcoma	Stimulate	33114687
Liver Cirrhosis	Associate	24682220
Lung Diseases	Associate	26572277
Lung Neoplasms	Associate	16648865, 19305150, 22132110, 22591718, 23226337, 24108744, 26498639, 26968871, 28400509, 28487957, 28592245, 30022688, 30842489, 31613681, 33313952, 34205482, 35015757, 35226448 View all (3 more)
Lupus Erythematosus Systemic	Associate	22966240, 36075396
Lupus Nephritis	Associate	36335193
Lymphatic Metastasis	Associate	14997206, 23083134, 24682903, 24966948, 25120769
Lymphoma	Associate	20117835
Lymphoma B Cell	Associate	27235588
Lymphoma Follicular	Associate	16835385
Lymphoma Large B Cell Diffuse	Associate	27282353
Lymphoma Large Cell Anaplastic	Associate	17690253
Lymphoma Non Hodgkin	Stimulate	19298651
Lymphoma Non Hodgkin	Associate	38613141
Lymphoma T Cell	Associate	34045609
Macular Degeneration	Associate	28045574
Malformations of Cortical Development Group I	Associate	15004016, 16766531, 26202867
Mammary Neoplasms Animal	Associate	18166657, 19457236
Marfan Syndrome	Associate	25767191
Medulloblastoma	Associate	19594892, 20811766, 28440450, 32818841, 35593307
Melanoma	Associate	11415463, 11997078, 12821662, 15145934, 15210734, 15987743, 16098043, 16254105, 16452469, 17508026, 18616526, 19188183, 19401689, 20149136, 20818433 View all (25 more)
Melanoma Cutaneous Malignant	Associate	16452469
Melorheostosis	Associate	35189151
Meningeal Carcinomatosis	Associate	31634779
Meningioma	Associate	17108064
Meningitis Meningococcal	Associate	34863201
Menkes Kinky Hair Syndrome	Associate	20070854
Mesothelioma	Associate	19551156, 21454801, 35319795
Mesothelioma Malignant	Associate	18096084
Microsatellite Instability	Associate	26171582
Mitochondrial Diseases	Associate	24161842
Mohr Tranebjaerg syndrome	Stimulate	30657558
Mouth Neoplasms	Associate	25091805, 26447615, 34318593
Multiple Myeloma	Associate	11986233, 21541441, 27581518, 28557972, 30353128, 35082402, 35216969, 36289430
Multiple Sclerosis	Associate	34284104, 36759259
Muscular Dystrophy Duchenne	Associate	36814107
Myasthenic Syndromes Congenital	Associate	16272363
Myelodysplastic Syndromes	Associate	11861273, 20823131
Myeloproliferative Disorders	Associate	17440089
Myocardial Infarction	Associate	36072560
Myofibrillar Myopathy	Associate	34830320
Myotonic Dystrophy	Associate	25214430, 28915272
Nasal Polyps	Associate	24609540, 36447209
Nasopharyngeal Carcinoma	Associate	23987636, 24806432, 24933637, 26617707, 31634779, 33096744, 33760180, 35864158
Nasopharyngeal Neoplasms	Associate	10929762, 29070520
Neoplasm Metastasis	Associate	17508026, 18823380, 22363545, 23637748, 26164082, 26498639, 28281966, 28440432, 28911625, 31378887, 31397118, 35725908, 36766731
Neoplasms	Associate	11078722, 12204060, 12937136, 14997206, 15160999, 15210734, 15489220, 16230611, 16251422, 16778083, 16835385, 17388789, 17690253, 17699110, 18853184 View all (99 more)
Neoplasms	Inhibit	19331166, 20824047, 34919787, 35082402
Neoplasms	Stimulate	31253108, 9223425
Neoplasms Glandular and Epithelial	Associate	16489115
Neoplasms Squamous Cell	Associate	29327713
Nephrotic Syndrome	Associate	34873575
Nephrotic Syndrome	Stimulate	35514316
Nerve Degeneration	Associate	25563324
Neuroblastoma	Associate	15485492, 20490331, 22192458, 22342995, 22948716, 26384788, 30359286, 32336043, 33619241, 35742955
Neuroendocrine Tumors	Associate	20407018
Neurofibrosarcoma	Associate	25109740
Nevus Pigmented	Associate	16254105
Niemann Pick Disease Type C	Associate	24068806
Non alcoholic Fatty Liver Disease	Associate	34828420, 37861538
Noonan Syndrome	Associate	32514133
Obesity	Associate	23110196, 25332687, 31412932, 35937803
Obesity Morbid	Associate	33621651
Ophthalmoplegia Chronic Progressive External	Associate	19477272
Orofacial Cleft 1	Associate	26561393
Ossification of Posterior Longitudinal Ligament	Associate	17702747
Osteoarthritis	Associate	17129375, 18416822, 19302240, 20155832, 26352263, 26982743, 29339024, 33926561
Osteogenesis Imperfecta	Associate	33228694
Osteopetrosis	Associate	33396517
Osteoporosis	Associate	18433299, 37971455
Osteosarcoma	Associate	21622131, 22179790, 25146150, 30942624, 36047196
Otofaciocervical Syndrome	Associate	26561393
Ovarian Neoplasms	Associate	23158473, 23236423, 23820584, 24662131, 26617770, 27458161, 30106144, 32102425, 32495860, 32796926, 33921111, 34027641, 35008474, 35621926, 37420173
Pancreatic Neoplasms	Associate	16209712, 18571585, 20551957, 21678462, 22472349, 24294133, 25880226, 26785721, 29049217, 30942624, 31948053, 36017891
Pelvic Organ Prolapse	Associate	29737911, 31116709
Periodontitis	Associate	30355945
Peripheral Vascular Diseases	Associate	38206683
Polycystic Kidney Diseases	Associate	8808768
Polycystic Ovary Syndrome	Associate	31452406, 35768803, 37565925
Pre Eclampsia	Associate	30821550
Precancerous Conditions	Associate	30942624
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17351113, 34830095
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	27776559, 31943135, 35805156
Premature Birth	Associate	25583406
Primary Myelofibrosis	Associate	35356507
Prostatic Hyperplasia	Stimulate	21081304
Prostatic Neoplasms	Associate	17178731, 18787043, 18922979, 20979115, 21076047, 21081304, 21871886, 23424616, 24619413, 24982891, 25481381, 25592066, 26257301, 26983806, 28252001 View all (14 more)
Prostatic Neoplasms Castration Resistant	Associate	30804427
Prostatitis	Associate	36060138
Psychotic Disorders	Associate	29945223
Pulmonary Arterial Hypertension	Associate	21498912, 28428963
Pulmonary Atelectasis	Associate	32561683
Pulmonary Disease Chronic Obstructive	Stimulate	22518834
Pulmonary Disease Chronic Obstructive	Associate	29874112
Retinitis Pigmentosa	Associate	22848708
Retinoblastoma	Associate	22457763
Rhabdomyoma	Associate	26247533
Salivary Gland Neoplasms	Associate	12937136
Sarcoma	Associate	34321458
Sarcoma Ewing	Associate	40628996
Schizophrenia	Associate	36114287, 37418754
Scleroderma Systemic	Associate	29720235
Skull Base Neoplasms	Associate	28482067
Sleep Apnea Obstructive	Associate	30778913, 34239024
Sleep Deprivation	Associate	36748964
Small Cell Lung Carcinoma	Associate	15613460, 23651505, 36931608
Smoke Inhalation Injury	Associate	37084641
Solitary Fibrous Tumors	Associate	31201369
Squamous Cell Carcinoma of Head and Neck	Associate	18472963, 19331166, 23146907, 24565984, 24669014, 24682903, 30893332, 34445346, 36672272, 36929425, 39215239
Status Asthmaticus	Associate	17127048, 20926789
Stomach Neoplasms	Associate	12204060, 15655810, 17387271, 19858308, 20804754, 24946088, 25432133, 26242263, 27039174, 28012218, 28109082, 28252644, 28460635, 28627240, 30015980 View all (8 more)
Tachycardia Atrioventricular Nodal Reentry	Associate	27456359
Thymoma	Associate	32463597
Thyroid Cancer Papillary	Associate	21191179, 25499223, 35464760
Thyroid Neoplasms	Associate	18021179, 27342319, 34911834, 35464760, 37219859
Tinnitus	Associate	36401375
Tongue Diseases	Associate	36430348
Triple Negative Breast Neoplasms	Associate	24637719, 27038254, 29792166, 29936177, 33946884, 34185141, 37551997
Tuberculosis Multidrug Resistant	Associate	27129170
Tuberculosis Pulmonary	Associate	16622205, 38075560
Tuberous Sclerosis	Associate	21767323
Urinary Bladder Neoplasms	Associate	18472007, 20473523, 23698120, 25132950, 26823699, 32865871
Urinary Incontinence Stress	Associate	23867452
Urologic Diseases	Associate	21191629
Uterine Cervical Neoplasms	Associate	11731569, 25120769, 25124631, 26156805, 26701206, 29267213, 31081078, 31424656, 31922210, 36645157, 37754347, 38537385
Uveal melanoma	Associate	15145934, 22253748, 22653968, 24551032, 25166211, 31173078, 31736361
Uveitis	Associate	23401649
Vascular Diseases	Associate	28427390
Vascular System Injuries	Associate	36937538
Vitamin K Deficiency	Associate	17699110
Vitreoretinopathy Proliferative	Associate	15988409, 24788939
Waldenstrom Macroglobulinemia	Associate	25748087
Walker Warburg Syndrome	Associate	34653404
WHIM syndrome	Associate	19956569, 33485325
Wilms Tumor	Associate	23922674
Wounds and Injuries	Associate	32206064

MAPK3 (mitogen-activated protein kinase 3)