Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5600
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPK11
Synonyms (NCBI Gene) Gene synonyms aliases	P38B, P38BETA2, PRKM11, SAPK2, SAPK2B, p38-2, p38Beta
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a family of protein kinases that are involved in the integration of biochemical signals for a wide variety of cellular processes, including cell proliferation, differentiation, transcriptional regulation, and development. The

Show/Hide all(28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003097	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR	19296470
MIRT022536	hsa-miR-124-3p	Microarray	18668037
MIRT052537	hsa-let-7a-5p	CLASH	23622248
MIRT1130063	hsa-miR-1205	CLIP-seq
MIRT1130064	hsa-miR-1302	CLIP-seq
MIRT1130065	hsa-miR-1909	CLIP-seq
MIRT1130066	hsa-miR-298	CLIP-seq
MIRT1130067	hsa-miR-3663-3p	CLIP-seq
MIRT1130068	hsa-miR-3918	CLIP-seq
MIRT1130069	hsa-miR-4298	CLIP-seq
MIRT1130070	hsa-miR-4330	CLIP-seq
MIRT1130071	hsa-miR-4436b-3p	CLIP-seq
MIRT1130072	hsa-miR-4640-5p	CLIP-seq
MIRT1130073	hsa-miR-4726-5p	CLIP-seq
MIRT1130074	hsa-miR-541	CLIP-seq
MIRT1130075	hsa-miR-574-3p	CLIP-seq
MIRT1130076	hsa-miR-602	CLIP-seq
MIRT1130077	hsa-miR-654-5p	CLIP-seq
MIRT2037035	hsa-miR-204	CLIP-seq
MIRT2037036	hsa-miR-211	CLIP-seq
MIRT2037037	hsa-miR-4643	CLIP-seq
MIRT2037038	hsa-miR-627	CLIP-seq
MIRT2267113	hsa-miR-1915	CLIP-seq
MIRT2453706	hsa-miR-296-5p	CLIP-seq
MIRT2453707	hsa-miR-4292	CLIP-seq
MIRT2453708	hsa-miR-4308	CLIP-seq
MIRT2453709	hsa-miR-4749-3p	CLIP-seq
MIRT2453710	hsa-miR-670	CLIP-seq

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	35857590
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IDA	8663524, 10330143
GO:0004707	Function	MAP kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	17254968, 17380123, 21988832, 23602568, 28514442, 32707033, 32814053, 33961781, 35271311, 35512704
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0010628	Process	Positive regulation of gene expression	IMP	25754930
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IDA	35857590
GO:0032735	Process	Positive regulation of interleukin-12 production	IEA
GO:0032735	Process	Positive regulation of interleukin-12 production	IMP	25754930
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0038066	Process	P38MAPK cascade	IDA	10330143
GO:0038066	Process	P38MAPK cascade	TAS
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	23483889
GO:0051149	Process	Positive regulation of muscle cell differentiation	IEA
GO:0051149	Process	Positive regulation of muscle cell differentiation	TAS
GO:0051403	Process	Stress-activated MAPK cascade	IDA	8663524, 35857590
GO:0051403	Process	Stress-activated MAPK cascade	IEA
GO:0051604	Process	Protein maturation	IDA	32109412
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060043	Process	Regulation of cardiac muscle cell proliferation	IEA
GO:0060044	Process	Negative regulation of cardiac muscle cell proliferation	IEA
GO:0060348	Process	Bone development	IEA
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32109412
GO:0071347	Process	Cellular response to interleukin-1	IDA	8663524
GO:0071493	Process	Cellular response to UV-B	IDA	35857590
GO:0071493	Process	Cellular response to UV-B	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0098586	Process	Cellular response to virus	IEA
GO:0098586	Process	Cellular response to virus	IMP	25754930
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1904784	Process	NLRP1 inflammasome complex assembly	IDA	22665479

MIM	HGNC	e!Ensembl
602898	6873	ENSG00000185386

Protein

UniProt ID

Q15759

Protein name

Mitogen-activated protein kinase 11 (MAP kinase 11) (MAPK 11) (EC 2.7.11.24) (Mitogen-activated protein kinase p38 beta) (MAP kinase p38 beta) (p38b) (Stress-activated protein kinase 2b) (SAPK2b) (p38-2)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:12452429, PubMed:20626350, PubMed:35857590). MAPK11 is one of the four p38 MAPKs which play an important role in the cascades of c

PDB

3GC8 , 3GC9 , 3GP0 , 8YGW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	24 → 308	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in the brain and heart. Also expressed in the placenta, lung, liver, skeletal muscle, kidney and pancreas.

Sequence

MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ

Sequence length

364

Interactions

View interactions

MAPK11 (mitogen-activated protein kinase 11)