Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	5609
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase kinase 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAP2K7
Synonyms (NCBI Gene) Gene synonyms aliases	JNKK2, MAPKK7, MEK, MEK 7, MKK7, PRKMK7, SAPKK-4, SAPKK4
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase k

Show/Hide all(321)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045769	hsa-miR-125a-5p	CLASH	23622248
MIRT054426	hsa-miR-493-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	24533778
MIRT054426	hsa-miR-493-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	24533778
MIRT502019	hsa-miR-4311	PAR-CLIP	24398324
MIRT473843	hsa-miR-8080	PAR-CLIP	23592263
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT473840	hsa-miR-2278	PAR-CLIP	23592263
MIRT473839	hsa-miR-3125	PAR-CLIP	23592263
MIRT473838	hsa-miR-3916	PAR-CLIP	23592263
MIRT473837	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT473833	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT473832	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT473831	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT473830	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT473829	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT473828	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT473827	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT473826	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT473825	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT473823	hsa-miR-4458	PAR-CLIP	23592263
MIRT473824	hsa-miR-4500	PAR-CLIP	23592263
MIRT473822	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473820	hsa-miR-6077	PAR-CLIP	23592263
MIRT473818	hsa-miR-4451	PAR-CLIP	23592263
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT440290	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440290	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT473832	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT473832	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT473832	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT473832	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT473831	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT473831	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT473831	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT473831	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT473830	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT473830	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT473830	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT473830	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT473829	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT473829	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT473829	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT473829	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT473828	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT473828	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT473828	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT473828	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT473827	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT473827	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT473827	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT473827	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT473826	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT473826	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT473826	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT473826	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT473825	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT473825	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT473825	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT473825	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	26701625
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	26701625
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	26701625
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	26701625
MIRT473840	hsa-miR-2278	PAR-CLIP	26701625
MIRT473840	hsa-miR-2278	PAR-CLIP	26701625
MIRT473840	hsa-miR-2278	PAR-CLIP	26701625
MIRT473840	hsa-miR-2278	PAR-CLIP	26701625
MIRT473839	hsa-miR-3125	PAR-CLIP	26701625
MIRT473839	hsa-miR-3125	PAR-CLIP	26701625
MIRT473838	hsa-miR-3916	PAR-CLIP	26701625
MIRT473838	hsa-miR-3916	PAR-CLIP	26701625
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT473833	hsa-miR-3928-3p	PAR-CLIP	26701625
MIRT473833	hsa-miR-3928-3p	PAR-CLIP	26701625
MIRT473818	hsa-miR-4451	PAR-CLIP	26701625
MIRT473818	hsa-miR-4451	PAR-CLIP	26701625
MIRT473818	hsa-miR-4451	PAR-CLIP	26701625
MIRT473818	hsa-miR-4451	PAR-CLIP	26701625
MIRT473823	hsa-miR-4458	PAR-CLIP	26701625
MIRT473823	hsa-miR-4458	PAR-CLIP	26701625
MIRT473823	hsa-miR-4458	PAR-CLIP	26701625
MIRT473823	hsa-miR-4458	PAR-CLIP	26701625
MIRT473824	hsa-miR-4500	PAR-CLIP	26701625
MIRT473824	hsa-miR-4500	PAR-CLIP	26701625
MIRT473824	hsa-miR-4500	PAR-CLIP	26701625
MIRT473824	hsa-miR-4500	PAR-CLIP	26701625
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	26701625
MIRT473820	hsa-miR-6077	PAR-CLIP	26701625
MIRT473820	hsa-miR-6077	PAR-CLIP	26701625
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	26701625
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	26701625
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	26701625
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	26701625
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	26701625
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	26701625
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	26701625
MIRT473837	hsa-miR-6859-5p	PAR-CLIP	26701625
MIRT473837	hsa-miR-6859-5p	PAR-CLIP	26701625
MIRT473843	hsa-miR-8080	PAR-CLIP	26701625
MIRT473843	hsa-miR-8080	PAR-CLIP	26701625
MIRT473822	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT473822	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT473822	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT473822	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT502019	hsa-miR-4311	PAR-CLIP	27292025
MIRT734747	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR	33921710
MIRT736015	hsa-miR-331-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32776229
MIRT502019	hsa-miR-4311	PAR-CLIP	24398324
MIRT473843	hsa-miR-8080	PAR-CLIP	23592263
MIRT473842	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT473841	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT473840	hsa-miR-2278	PAR-CLIP	23592263
MIRT473839	hsa-miR-3125	PAR-CLIP	23592263
MIRT473838	hsa-miR-3916	PAR-CLIP	23592263
MIRT473837	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT473836	hsa-miR-6510-5p	PAR-CLIP	23592263
MIRT473835	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT473834	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT473833	hsa-miR-3928-3p	PAR-CLIP	23592263
MIRT473832	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT473831	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT473830	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT473829	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT473828	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT473827	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT473826	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT473825	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT473823	hsa-miR-4458	PAR-CLIP	23592263
MIRT473824	hsa-miR-4500	PAR-CLIP	23592263
MIRT473822	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT473821	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT473819	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT473820	hsa-miR-6077	PAR-CLIP	23592263
MIRT473818	hsa-miR-4451	PAR-CLIP	23592263
MIRT473817	hsa-miR-4732-5p	PAR-CLIP	23592263
MIRT1128094	hsa-let-7a	CLIP-seq
MIRT1128095	hsa-let-7b	CLIP-seq
MIRT1128096	hsa-let-7c	CLIP-seq
MIRT1128097	hsa-let-7d	CLIP-seq
MIRT1128098	hsa-let-7e	CLIP-seq
MIRT1128099	hsa-let-7f	CLIP-seq
MIRT1128100	hsa-let-7g	CLIP-seq
MIRT1128101	hsa-let-7i	CLIP-seq
MIRT1128102	hsa-miR-1287	CLIP-seq
MIRT1128103	hsa-miR-1538	CLIP-seq
MIRT1128104	hsa-miR-1908	CLIP-seq
MIRT1128105	hsa-miR-1909	CLIP-seq
MIRT1128106	hsa-miR-2861	CLIP-seq
MIRT1128107	hsa-miR-3150a-3p	CLIP-seq
MIRT1128108	hsa-miR-3175	CLIP-seq
MIRT1128109	hsa-miR-3180	CLIP-seq
MIRT1128110	hsa-miR-3180-3p	CLIP-seq
MIRT1128111	hsa-miR-3187-3p	CLIP-seq
MIRT1128112	hsa-miR-3196	CLIP-seq
MIRT1128113	hsa-miR-3689a-3p	CLIP-seq
MIRT1128114	hsa-miR-3689c	CLIP-seq
MIRT1128115	hsa-miR-3927	CLIP-seq
MIRT1128116	hsa-miR-4529-5p	CLIP-seq
MIRT1128117	hsa-miR-4532	CLIP-seq
MIRT1128118	hsa-miR-4640-5p	CLIP-seq
MIRT1128119	hsa-miR-4651	CLIP-seq
MIRT1128120	hsa-miR-4726-5p	CLIP-seq
MIRT1128121	hsa-miR-4745-3p	CLIP-seq
MIRT1128122	hsa-miR-4747-3p	CLIP-seq
MIRT1128123	hsa-miR-491-5p	CLIP-seq
MIRT1128124	hsa-miR-603	CLIP-seq
MIRT1128125	hsa-miR-608	CLIP-seq
MIRT1128126	hsa-miR-663	CLIP-seq
MIRT1128127	hsa-miR-663b	CLIP-seq
MIRT1128128	hsa-miR-939	CLIP-seq
MIRT1128129	hsa-miR-98	CLIP-seq
MIRT1551118	hsa-miR-1197	CLIP-seq
MIRT2036417	hsa-miR-1913	CLIP-seq
MIRT2036418	hsa-miR-3130-3p	CLIP-seq
MIRT1128111	hsa-miR-3187-3p	CLIP-seq
MIRT2036419	hsa-miR-3189-5p	CLIP-seq
MIRT2036420	hsa-miR-3191	CLIP-seq
MIRT2036421	hsa-miR-3194-3p	CLIP-seq
MIRT2036422	hsa-miR-324-3p	CLIP-seq
MIRT2036423	hsa-miR-328	CLIP-seq
MIRT2036424	hsa-miR-3622a-3p	CLIP-seq
MIRT2036425	hsa-miR-3622b-3p	CLIP-seq
MIRT2036426	hsa-miR-370	CLIP-seq
MIRT2036427	hsa-miR-4287	CLIP-seq
MIRT2036428	hsa-miR-4292	CLIP-seq
MIRT2036429	hsa-miR-4313	CLIP-seq
MIRT2036430	hsa-miR-4447	CLIP-seq
MIRT2036431	hsa-miR-4472	CLIP-seq
MIRT1128116	hsa-miR-4529-5p	CLIP-seq
MIRT1128119	hsa-miR-4651	CLIP-seq
MIRT2036432	hsa-miR-4685-3p	CLIP-seq
MIRT2036433	hsa-miR-4758-3p	CLIP-seq
MIRT2036434	hsa-miR-4780	CLIP-seq
MIRT2036435	hsa-miR-4793-3p	CLIP-seq
MIRT2036436	hsa-miR-541	CLIP-seq
MIRT1128124	hsa-miR-603	CLIP-seq
MIRT1128125	hsa-miR-608	CLIP-seq
MIRT2036437	hsa-miR-623	CLIP-seq
MIRT2036438	hsa-miR-654-5p	CLIP-seq
MIRT1128127	hsa-miR-663b	CLIP-seq
MIRT2036439	hsa-miR-670	CLIP-seq
MIRT2036440	hsa-miR-767-5p	CLIP-seq
MIRT1128094	hsa-let-7a	CLIP-seq
MIRT1128095	hsa-let-7b	CLIP-seq
MIRT1128096	hsa-let-7c	CLIP-seq
MIRT1128097	hsa-let-7d	CLIP-seq
MIRT1128098	hsa-let-7e	CLIP-seq
MIRT1128099	hsa-let-7f	CLIP-seq
MIRT1128100	hsa-let-7g	CLIP-seq
MIRT1128101	hsa-let-7i	CLIP-seq
MIRT2266663	hsa-miR-1234	CLIP-seq
MIRT2266664	hsa-miR-125b	CLIP-seq
MIRT2266665	hsa-miR-128	CLIP-seq
MIRT1128102	hsa-miR-1287	CLIP-seq
MIRT2266666	hsa-miR-141	CLIP-seq
MIRT2266667	hsa-miR-1468	CLIP-seq
MIRT1128105	hsa-miR-1909	CLIP-seq
MIRT2266668	hsa-miR-1976	CLIP-seq
MIRT2266669	hsa-miR-200a	CLIP-seq
MIRT2266670	hsa-miR-27a	CLIP-seq
MIRT2266671	hsa-miR-27b	CLIP-seq
MIRT2036418	hsa-miR-3130-3p	CLIP-seq
MIRT2266672	hsa-miR-3150b-3p	CLIP-seq
MIRT2266673	hsa-miR-3179	CLIP-seq
MIRT2036419	hsa-miR-3189-5p	CLIP-seq
MIRT2036420	hsa-miR-3191	CLIP-seq
MIRT2036421	hsa-miR-3194-3p	CLIP-seq
MIRT2266674	hsa-miR-329	CLIP-seq
MIRT2036424	hsa-miR-3622a-3p	CLIP-seq
MIRT2036425	hsa-miR-3622b-3p	CLIP-seq
MIRT2266675	hsa-miR-362-3p	CLIP-seq
MIRT1128113	hsa-miR-3689a-3p	CLIP-seq
MIRT1128114	hsa-miR-3689c	CLIP-seq
MIRT2036426	hsa-miR-370	CLIP-seq
MIRT1128115	hsa-miR-3927	CLIP-seq
MIRT2266676	hsa-miR-421	CLIP-seq
MIRT2266677	hsa-miR-4319	CLIP-seq
MIRT2266678	hsa-miR-4431	CLIP-seq
MIRT2266679	hsa-miR-4438	CLIP-seq
MIRT2036430	hsa-miR-4447	CLIP-seq
MIRT2036431	hsa-miR-4472	CLIP-seq
MIRT2266680	hsa-miR-4493	CLIP-seq
MIRT2266681	hsa-miR-4522	CLIP-seq
MIRT1128116	hsa-miR-4529-5p	CLIP-seq
MIRT2266682	hsa-miR-4640-3p	CLIP-seq
MIRT1128118	hsa-miR-4640-5p	CLIP-seq
MIRT1128119	hsa-miR-4651	CLIP-seq
MIRT2266683	hsa-miR-4667-3p	CLIP-seq
MIRT2266684	hsa-miR-4709-5p	CLIP-seq
MIRT2266685	hsa-miR-4714-5p	CLIP-seq
MIRT1128120	hsa-miR-4726-5p	CLIP-seq
MIRT2266686	hsa-miR-4732-3p	CLIP-seq
MIRT2266687	hsa-miR-4753-5p	CLIP-seq
MIRT2266688	hsa-miR-4755-3p	CLIP-seq
MIRT2036433	hsa-miR-4758-3p	CLIP-seq
MIRT2266689	hsa-miR-4762-3p	CLIP-seq
MIRT2266690	hsa-miR-4784	CLIP-seq
MIRT2036435	hsa-miR-4793-3p	CLIP-seq
MIRT2266691	hsa-miR-4793-5p	CLIP-seq
MIRT2266692	hsa-miR-485-5p	CLIP-seq
MIRT2266693	hsa-miR-493	CLIP-seq
MIRT2266694	hsa-miR-505	CLIP-seq
MIRT2266695	hsa-miR-513a-5p	CLIP-seq
MIRT2036436	hsa-miR-541	CLIP-seq
MIRT2266696	hsa-miR-548n	CLIP-seq
MIRT2266697	hsa-miR-548t	CLIP-seq
MIRT2266698	hsa-miR-561	CLIP-seq
MIRT1128124	hsa-miR-603	CLIP-seq
MIRT2266699	hsa-miR-604	CLIP-seq
MIRT1128125	hsa-miR-608	CLIP-seq
MIRT2266700	hsa-miR-626	CLIP-seq
MIRT2036438	hsa-miR-654-5p	CLIP-seq
MIRT2036439	hsa-miR-670	CLIP-seq
MIRT2036440	hsa-miR-767-5p	CLIP-seq
MIRT1128129	hsa-miR-98	CLIP-seq
MIRT2390556	hsa-miR-1291	CLIP-seq
MIRT2390557	hsa-miR-1914	CLIP-seq
MIRT2036423	hsa-miR-328	CLIP-seq
MIRT2390558	hsa-miR-3649	CLIP-seq
MIRT2036428	hsa-miR-4292	CLIP-seq
MIRT2566310	hsa-miR-1470	CLIP-seq
MIRT2036418	hsa-miR-3130-3p	CLIP-seq
MIRT2036421	hsa-miR-3194-3p	CLIP-seq
MIRT2036424	hsa-miR-3622a-3p	CLIP-seq
MIRT2036425	hsa-miR-3622b-3p	CLIP-seq
MIRT2266683	hsa-miR-4667-3p	CLIP-seq
MIRT2036435	hsa-miR-4793-3p	CLIP-seq
MIRT2036440	hsa-miR-767-5p	CLIP-seq
MIRT2566310	hsa-miR-1470	CLIP-seq
MIRT2036418	hsa-miR-3130-3p	CLIP-seq
MIRT2036421	hsa-miR-3194-3p	CLIP-seq
MIRT2036424	hsa-miR-3622a-3p	CLIP-seq
MIRT2036425	hsa-miR-3622b-3p	CLIP-seq
MIRT2266683	hsa-miR-4667-3p	CLIP-seq
MIRT2036435	hsa-miR-4793-3p	CLIP-seq
MIRT2036440	hsa-miR-767-5p	CLIP-seq

Show/Hide all(32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	IBA	21873635
GO:0000287	Function	Magnesium ion binding	IDA	9535930
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	IBA	21873635
GO:0004708	Function	MAP kinase kinase activity	IDA	9535930
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	15299019, 16840345, 17110930, 17709393, 18286207, 20067578, 25241761, 25284480, 25314077
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006970	Process	Response to osmotic stress	IDA	9535930
GO:0007165	Process	Signal transduction	TAS	9535930
GO:0007254	Process	JNK cascade	TAS
GO:0007257	Process	Activation of JUN kinase activity	IBA	21873635
GO:0007257	Process	Activation of JUN kinase activity	ISS
GO:0008545	Function	JUN kinase kinase activity	IBA	21873635
GO:0009408	Process	Response to heat	IDA	9535930
GO:0009411	Process	Response to UV	IDA	9535930
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IEA
GO:0019899	Function	Enzyme binding	IPI	14615289
GO:0019901	Function	Protein kinase binding	IPI	14697235
GO:0019903	Function	Protein phosphatase binding	ISS
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	21531765
GO:0034612	Process	Response to tumor necrosis factor	IDA	9535930
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	28111074
GO:0051403	Process	Stress-activated MAPK cascade	IDA	9535930
GO:0051973	Process	Positive regulation of telomerase activity	IMP	21531765
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	28111074
GO:1904355	Process	Positive regulation of telomere capping	IMP	21531765

MIM	HGNC	e!Ensembl
603014	6847	ENSG00000076984

Protein

UniProt ID

O14733

Protein name

Dual specificity mitogen-activated protein kinase kinase 7 (MAP kinase kinase 7) (MAPKK 7) (EC 2.7.12.2) (JNK-activating kinase 2) (MAPK/ERK kinase 7) (MEK 7) (Stress-activated protein kinase kinase 4) (SAPK kinase 4) (SAPKK-4) (SAPKK4) (c-Jun N-terminal

Protein function

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. Essential component of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway. With MAP2K4/MKK4,

PDB

2DYL , 3WZU , 4UX9 , 5B2K , 5B2L , 5B2M , 5Y8U , 5Y90 , 5Z1D , 5Z1E , 6IB0 , 6IB2 , 6QFL , 6QFR , 6QFT , 6QG4 , 6QG7 , 6QHO , 6QHR , 6YFZ , 6YG0 , 6YG1 , 6YG2 , 6YG3 , 6YG4 , 6YG5 , 6YG6 , 6YG7 , 6YZ4 , 7CBX , 7OVI , 7OVJ , 7OVK , 7OVL , 7OVM , 7OVN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	120 → 380	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous; with highest level of expression in skeletal muscle. Isoform 3 is found at low levels in placenta, fetal liver, and skeletal muscle. {ECO:0000269|PubMed:16442502, ECO:0000269|PubMed:9372971, ECO:0000269|PubMed:9535930}.

Sequence

MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR

Sequence length

419

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Diabetes	Diabetes	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS

Show/Hide Text Mining Associations (225)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	24037752, 27763636, 35228614
Adenocarcinoma of Lung	Associate	30815935, 33426073, 36263632, 37182602, 40184641
Adenoma	Inhibit	10584870
Adenoma	Associate	23919615, 30111351
Alcoholism	Associate	26700849
Ameloblastoma	Associate	29388014, 35689405
Anaplasmosis	Associate	19283084
Anemia Aplastic	Inhibit	40406144
Angioedemas Hereditary	Associate	11050091
Aortic Dissection	Associate	28076932, 30816458
Arteriovenous Malformations	Associate	35343049
Arthritis Rheumatoid	Associate	13130464, 16802349
Astrocytoma	Associate	27810072, 30575814, 37280243, 40565357
Biliary Tract Neoplasms	Associate	26683364, 30563938, 31312030
Brain Neoplasms	Associate	34625515
Breast Neoplasms	Associate	12838322, 15723837, 19317917, 19352700, 19514121, 19853943, 19952304, 20471474, 20591134, 20679487, 21278786, 21869603, 22105362, 22447278, 23127286 View all (17 more)
Carcinogenesis	Associate	12692057, 15729718, 22039425, 22121046, 22146979, 22147942, 23959801, 26156586, 31661126
Carcinoid Tumor	Associate	12851216
Carcinoma Acinar Cell	Associate	32843432
Carcinoma Hepatocellular	Associate	19321179, 19698189, 21316602, 21507240, 25794709, 26586395, 26620707, 28560380, 28877210, 29449645, 29763915, 30815935, 31852247, 33210432, 36137220, 37626338 View all (1 more)
Carcinoma Merkel Cell	Associate	16498399, 27212661, 34724284
Carcinoma Neuroendocrine	Inhibit	27048246
Carcinoma Non Small Cell Lung	Associate	19010912, 19305165, 19783898, 20008839, 22240786, 22247021, 22569000, 23259591, 23270470, 23869238, 24108744, 24318272, 24908424, 25937299, 25948105 View all (23 more)
Carcinoma Ovarian Epithelial	Associate	22543706
Carcinoma Pancreatic Ductal	Associate	17353198, 23918833, 26251290, 29298720, 30261145, 31583713, 36694355
Carcinoma Renal Cell	Associate	26097571, 30048489, 31438640, 32331211, 32413671
Carcinoma Small Cell	Associate	37189139
Carcinoma Squamous Cell	Stimulate	22389437
Carcinoma Squamous Cell	Associate	24037752, 32521923
Cardiofaciocutaneous syndrome	Associate	17704260
Cardiomyopathy Hypertrophic	Associate	35052347
Cardiovascular Diseases	Associate	36896641
Cardiovascular Diseases	Inhibit	37534686
Cell Transformation Neoplastic	Associate	17376931, 36763589
Central Nervous System Infections	Associate	31921404
Central Nervous System Vascular Malformations	Associate	35343049
Cerebral Infarction	Associate	36168877
Cholangiocarcinoma	Associate	12692057, 23391555, 30400838
Chondrosarcoma	Associate	10765924, 31809267, 37928274
Chordoma	Associate	24445144
Chorea Gravidarum	Associate	32271498
Colonic Neoplasms	Associate	15757891, 25885658
Colorectal Neoplasms	Inhibit	10584870
Colorectal Neoplasms	Associate	12077118, 12676582, 19372556, 19686845, 20413844, 21071512, 21170361, 22569000, 22773810, 22909976, 23438367, 23624914, 23757356, 24330663, 24533778 View all (52 more)
Costello Syndrome	Associate	17704260
COVID 19	Associate	32307550, 33627767, 35102208
Craniopharyngioma	Associate	28425764, 29509940, 37683921, 39976897, 40128998
Death	Associate	36201194
Developmental Disabilities	Associate	17704260, 32155425
Diabetic Retinopathy	Associate	37635064
Diarrhea	Inhibit	34331515
Diffuse Intrinsic Pontine Glioma	Associate	34737188
Diffuse Neurofibrillary Tangles with Calcification	Associate	20056128
Drug Related Side Effects and Adverse Reactions	Associate	12838322, 15375172, 16418332, 16450001, 21134369, 23259591, 24739393, 25684207, 27655129, 36060138, 37629110
Drug Related Side Effects and Adverse Reactions	Inhibit	22773546, 32962812
Drug Related Side Effects and Adverse Reactions	Stimulate	33468562
Dyserythropoiesis Congenital with Internuclear Chromatin Bridges and Ultrastructurally Normal Erythroblast Heterochromatin	Associate	35228392
Endometrial Neoplasms	Associate	19432902, 23674493, 28498246, 29426295, 30445932, 31623857
Endometriosis	Associate	30281322
Epilepsy Idiopathic Generalized	Associate	17110434
Erdheim Chester Disease	Associate	25150293, 27940476, 34785791, 34957931
Esophageal Neoplasms	Associate	32831056
Esophageal Squamous Cell Carcinoma	Associate	25620088, 25915860, 28927233, 32945416, 33880577, 36848349
Familial cylindromatosis	Associate	22832488
Fibrolamellar hepatocellular carcinoma	Associate	32294439
Fibrosarcoma	Associate	11121417, 21898400, 35228392
Fibrosis	Associate	30483803
Gallbladder Neoplasms	Associate	23391555
Ganglioglioma	Associate	24374956
Gastrointestinal Diseases	Inhibit	34436699
Gastrointestinal Stromal Tumors	Associate	18615679, 22773810, 27777072, 33472910, 37475847
Glioblastoma	Associate	15618223, 19458076, 22077956, 25913706, 27132626, 27884160, 30289729, 35269397, 37277696, 37481865
Glioma	Associate	22520038, 23991044, 27884160, 30085274
Glut1 Deficiency Syndrome	Associate	19103208
Glycogen Storage Disease Type II	Associate	23940728
Head and Neck Neoplasms	Associate	36769112
Hepatitis B Chronic	Associate	29763915
Hepatitis C	Stimulate	22114332
Hepatoblastoma	Associate	32871763
Histiocytoma Malignant Fibrous	Associate	24676456
Histiocytosis	Associate	26566875, 32051554, 34935192
Histiocytosis Langerhans Cell	Associate	24982505, 26637773, 28679432, 30154124
Histiocytosis Non Langerhans Cell	Associate	26566875, 36857436
Histiocytosis Sinus	Associate	36201194, 36857436
HIV Infections	Associate	26544592
Hodgkin Disease	Associate	12689928
Hyperpigmentation	Associate	31399133
Hyperplasia	Associate	21505178
Hypertensive Retinopathy	Stimulate	30255823
Hypertensive Retinopathy	Associate	37534686
Hypopharyngeal Neoplasms	Associate	33529506
Hypophosphatemia	Stimulate	21858050
Hypophosphatemia	Associate	35999193
Hypoxia	Associate	21698228, 24117380
Immunoglobulin G4 Related Disease	Associate	16351709
Infarction Middle Cerebral Artery	Associate	28640835
Infections	Associate	21698228, 23797008, 36674756
Inflammation	Associate	17848581, 22573806, 32051554, 35102208, 36419183, 37430058, 37738562
Inflammatory Breast Neoplasms	Associate	22295107
Influenza Human	Associate	24641803
Influenza Human	Stimulate	29059211
Intestinal Diseases	Associate	29444910
Intestinal Perforation	Inhibit	34436699
Keratosis Actinic	Associate	22389437
Kidney Neoplasms	Associate	35108425
Klippel Trenaunay Weber Syndrome	Associate	35343049
Laryngeal Neoplasms	Associate	32791689
Leukemia	Associate	12642693, 15494423, 15517875, 17949889, 18394702, 19773546, 20362031, 20836852, 24589925, 25480661, 31646826, 32862609
Leukemia Biphenotypic Acute	Associate	27196001, 27588400
Leukemia Hairy Cell	Associate	21663470, 23349307, 25480661, 25700421, 38440808
Leukemia Lymphocytic Chronic B Cell	Associate	16846476, 17928528, 21483442, 21979753, 25329694, 34861096
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	11238126
Leukemia Myeloid Acute	Associate	10339498, 11238126, 11560954, 17077328, 19773546, 23825585, 24739393, 27036514, 27074819, 27249593, 28235190, 30635233, 30799283, 31123034, 32882760, 33375770, 37629110 View all (2 more)
Leukemia Myeloid Acute	Inhibit	40406144
Leukemia Myelomonocytic Juvenile	Associate	18024410, 23620576
Leukemia Prolymphocytic T Cell	Associate	27469405
Leukemia Promyelocytic Acute	Associate	17077328, 18445086
Liposarcoma	Associate	26518767
Lown Ganong Levine Syndrome	Associate	31085763
Lung Neoplasms	Associate	18424438, 19010912, 19783898, 20885957, 22753015, 22948716, 23815882, 25351745, 26560124, 26901483, 29079711, 29132432, 29961751, 30022688, 31668570, 37189139, 38109210, 40597801 View all (3 more)
Lung Neoplasms	Inhibit	24908424
Lupus Erythematosus Systemic	Associate	23775084, 33282947
Lymphangiectasia pulmonary congenital	Associate	32894644
Lymphedema	Associate	30947262
Lymphoma	Associate	11106658, 20117835
Lymphoma B Cell	Associate	32894644
Lymphoma Follicular	Associate	18682601
Lymphoma Large B Cell Diffuse	Associate	35039569
Lymphoma Non Hodgkin	Associate	37738646
Lymphoma T Cell	Associate	26854024
Lymphoma T Cell Cutaneous	Associate	23532732, 28537899
Lymphoma T Cell Peripheral	Associate	22801959
Medulloblastoma	Associate	12709419
Melanocytic nevus syndrome congenital	Associate	37716647
Melanoma	Associate	12917419, 15184373, 16410717, 17050671, 17245336, 17482134, 18008004, 18045987, 18323781, 18386001, 18668140, 18701495, 19078992, 19244105, 19915144 View all (176 more)
Melanoma Cutaneous Malignant	Associate	21828154, 24576830
Mesothelioma	Associate	24762959
Mesothelioma Malignant	Associate	16619474, 23817184
Mitochondrial Diseases	Associate	29516570
Mouth Diseases	Associate	22447278
Mouth Neoplasms	Associate	26919242, 36901935
Multi centric Castleman's Disease	Associate	32051554
Multiple Myeloma	Associate	12433678, 16418332, 17363736, 20930946, 21163924, 22985491, 23185517, 26630652, 28557972, 29654269, 30846494, 32043788, 32228485, 32747568, 34518309, 34861096, 36115844, 36608320 View all (3 more)
Multiple Sclerosis	Stimulate	34308699
Muscular dystrophy congenital with central nervous system involvement	Associate	32043788
Myelodysplastic Syndromes	Associate	34620690, 40406144
N syndrome	Associate	27655129
Nasopharyngeal Carcinoma	Associate	29364482, 32964977
Nasopharyngeal Neoplasms	Associate	33277860
Neoplasm Metastasis	Associate	16619474, 22447278, 22697792, 24138815, 24330663, 25448881, 29190630, 29403024, 30809081, 31685261, 32629699, 35363931, 36142409, 36799665, 37626338, 38148635 View all (1 more)
Neoplasm Metastasis	Stimulate	24533778
Neoplasm Metastasis	Inhibit	27616484
Neoplasms	Associate	10945503, 11038347, 12709419, 15375172, 15689620, 16101130, 16364920, 16395408, 16899113, 17095020, 17135242, 17311103, 18172009, 18203287, 18719078 View all (134 more)
Neoplasms	Inhibit	29666306, 35913398, 35945463
Neoplasms	Stimulate	29668670
Neoplasms Cystic Mucinous and Serous	Associate	28640835, 35328764
Neoplasms Germ Cell and Embryonal	Associate	16880791
Neoplasms Glandular and Epithelial	Associate	32645560
Nephrotic Syndrome	Associate	28433687
Nerve Degeneration	Associate	36168877
Neurilemmoma	Associate	26549023, 33025139
Neuroblastoma	Associate	22948716, 26384788, 26517508, 26821351, 26925841, 31672841, 36135081, 36398965
Neurocutaneous melanosis	Associate	24713450
Neuroendocrine Tumors	Associate	31937620, 9421477
Neurofibroma Plexiform	Associate	35363510
Neurofibromatosis 1	Associate	32608378
Neurofibrosarcoma	Associate	27494873, 33452215
Nevus Pigmented	Associate	27015094
Nonseminomatous germ cell tumor	Associate	32721511
Noonan Syndrome	Associate	17704260, 35052347
Oncogene Addiction	Associate	11278725, 35046109
Osteoarthritis	Associate	13130464
Osteosarcoma	Associate	22506069, 23403511, 30135419, 37591850
Ototoxicity	Inhibit	34436699
Ovarian Diseases	Associate	16815388
Ovarian Neoplasms	Associate	20661131, 22543706, 23820584, 26526982, 27129169, 31159852, 31395751, 32291856, 33000231, 33043759, 34794740, 36245227, 36362153, 37445830, 37779141, 38109210 View all (1 more)
Pain	Associate	33025139
Pancreatic Neoplasms	Associate	16311341, 19671674, 21386633, 23180942, 23764046, 23918833, 24294133, 24301926, 24392017, 25167228, 25271986, 25961376, 26251290, 28957417, 30261145 View all (10 more)
Pancreatitis	Associate	29444910
Papilloma Inverted	Associate	37891239
Paraproteinemias	Associate	26090869
Pdgfrb Associated Chronic Eosinophilic Leukemia	Associate	32051554
Peritoneal Neoplasms	Associate	28640835
Pigmentation Disorders	Associate	31399133
Poikiloderma with Neutropenia	Associate	29055717
Polycystic Kidney Autosomal Dominant	Associate	10760082
Polycystic Kidney Diseases	Associate	21697238
Precancerous Conditions	Associate	33808483
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	27588400, 27997540, 29656114
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	15353558, 20701602, 24116827, 27776559, 32391634
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	34670357
Prostatic Hyperplasia	Associate	21081304
Prostatic Neoplasms	Associate	16847055, 21081304, 21871886, 23991415, 25971429, 26983806, 29898731, 30804427, 32264916, 32492656, 32851058, 33277863, 34183450
Prostatic Neoplasms Castration Resistant	Associate	26603105, 30804427, 30975734
Prostatitis	Associate	18350153, 34183450, 36060138
Pseudomyxoma Peritonei	Associate	28640835
Pulmonary Disease Chronic Obstructive	Associate	32063702
Pulmonary edema of mountaineers	Associate	24465776
Pyruvate Carboxylase Deficiency Disease	Associate	26505547
Retinal Diseases	Stimulate	30255823
Retinoblastoma	Associate	30664191, 31115482, 34036380
Rhabdomyosarcoma	Associate	16351709, 16899113
Rhabdomyosarcoma Embryonal	Associate	35801577
Rickets	Associate	35999193
Salivary Duct Calculi	Associate	30323086
Sarcoidosis	Inhibit	33312171
Sarcoma Kaposi	Associate	16699017, 17964626, 36674756
Schwannomatosis	Associate	33025139
Skin Diseases	Associate	37534686
Small Cell Lung Carcinoma	Associate	26287334, 37820992, 9421477
Squamous Cell Carcinoma of Head and Neck	Associate	20927317, 28151720, 31118072, 33227411, 36769112, 36916400, 38030062
Stomach Diseases	Associate	22442341
Stomach Neoplasms	Associate	19924065, 21047770, 21698158, 22821546, 23228105, 25448881, 26810190, 28350126, 28460635, 29666306, 29668670, 30015980, 34002670, 35866593, 37037864, 37691391 View all (1 more)
Substance Related Disorders	Associate	35764309
Thyroid Cancer Papillary	Associate	15980887, 28423638, 31085763, 36799665
Thyroid Carcinoma Anaplastic	Associate	31077090, 37675898
Thyroid Neoplasms	Associate	18651802, 20332228, 22090271, 22641097, 25867065, 26828826, 28423638, 31882478, 37932340
Thyroiditis	Associate	26828826, 27852061
Triple Negative Breast Neoplasms	Associate	26537583, 29801480, 31527768, 32504034, 34168046, 37185776, 37879215
Tuberculosis	Associate	26544592
Urinary Bladder Neoplasms	Associate	22049531, 28388658, 28534984, 32865871, 36045117, 36142409
Uterine Cervical Neoplasms	Associate	29516570, 31703640, 35015607, 35659173, 37754347
Uterine Diseases	Associate	30281322
Uveal melanoma	Associate	16410717, 21828154, 22550165, 22733540, 24551032, 26059332, 28138035, 33126538, 33229459, 35332245, 36212716
Wilms Tumor	Associate	32238401, 36455140

MAP2K7 (mitogen-activated protein kinase kinase 7)