Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5608
Gene name	Mitogen-activated protein kinase kinase 6
Gene symbol	MAP2K6
Synonyms (NCBI Gene)	CRCMSLMAPKK6MEK6MKK6PRKMK6SAPKK-3SAPKK3
Chromosome	17
Chromosome location	17q24.3
Summary	This gene encodes a member of the dual specificity protein kinase family, which functions as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multipl

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016670	hsa-miR-425-5p	Sequencing	20371350
MIRT021513	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT053745	hsa-miR-29b-3p	Microarray	22942087
MIRT720403	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT720402	hsa-miR-5587-5p	HITS-CLIP	19536157
MIRT573371	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT573370	hsa-miR-1324	PAR-CLIP	20371350
MIRT573369	hsa-miR-922	PAR-CLIP	20371350
MIRT573368	hsa-miR-6804-5p	PAR-CLIP	20371350
MIRT573367	hsa-miR-3166	PAR-CLIP	20371350
MIRT573366	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT573365	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT573364	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT573363	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT573362	hsa-miR-8055	PAR-CLIP	20371350
MIRT473850	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473849	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT473847	hsa-miR-4735-5p	PAR-CLIP	23592263
MIRT473848	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT473846	hsa-miR-4775	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473844	hsa-miR-3149	PAR-CLIP	23592263
MIRT732300	hsa-miR-625-3p	Luciferase reporter assayqRT-PCRWestern blot	27526785
MIRT732300	hsa-miR-625-3p	Luciferase reporter assayqRT-PCRWestern blot	27526785
MIRT732300	hsa-miR-625-3p	Luciferase reporter assayqRT-PCRWestern blot	27526785
MIRT735799	hsa-miR-10a-5p	Luciferase reporter assayWestern blottingqRT-PCR	33128541
MIRT720403	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT720402	hsa-miR-5587-5p	HITS-CLIP	19536157
MIRT573371	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT573370	hsa-miR-1324	PAR-CLIP	20371350
MIRT573369	hsa-miR-922	PAR-CLIP	20371350
MIRT573368	hsa-miR-6804-5p	PAR-CLIP	20371350
MIRT573367	hsa-miR-3166	PAR-CLIP	20371350
MIRT573366	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT573365	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT573364	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT573363	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT573362	hsa-miR-8055	PAR-CLIP	20371350
MIRT473850	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473849	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT473847	hsa-miR-4735-5p	PAR-CLIP	23592263
MIRT473848	hsa-miR-6832-5p	PAR-CLIP	23592263
MIRT473846	hsa-miR-4775	PAR-CLIP	23592263
MIRT473845	hsa-miR-411-5p	PAR-CLIP	23592263
MIRT473844	hsa-miR-3149	PAR-CLIP	23592263
MIRT755867	hsa-miR-643	Luciferase reporter assayWestern blottingqRT-PCRIn situ hybridizationRNA pull down assay	34581623
MIRT1920611	hsa-miR-34c-3p	CLIP-seq
MIRT1920612	hsa-miR-374a	CLIP-seq
MIRT1920613	hsa-miR-374b	CLIP-seq
MIRT1920611	hsa-miR-34c-3p	CLIP-seq
MIRT1920612	hsa-miR-374a	CLIP-seq
MIRT1920613	hsa-miR-374b	CLIP-seq
MIRT2266661	hsa-miR-4305	CLIP-seq
MIRT2266662	hsa-miR-664	CLIP-seq

Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IBA
GO:0000165	Process	MAPK cascade	IDA	8663074
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004708	Function	MAP kinase kinase activity	IBA
GO:0004708	Function	MAP kinase kinase activity	IDA	8663074, 8663524, 9218798, 11460167
GO:0004708	Function	MAP kinase kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	TAS	10848581
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	11035004, 15229216, 17255949, 20067578, 32296183, 32707033, 32814053, 32911434
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9768359
GO:0005829	Component	Cytosol	IDA	9768359
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	TAS	8621675
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	11279118
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IDA	35857590
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IDA	35857590
GO:0031098	Process	Stress-activated protein kinase signaling cascade	IEA
GO:0035872	Process	Nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway	TAS
GO:0038066	Process	P38MAPK cascade	IDA	10330143
GO:0038066	Process	P38MAPK cascade	IDA	11460167
GO:0038066	Process	P38MAPK cascade	IEA
GO:0038066	Process	P38MAPK cascade	TAS
GO:0042770	Process	Signal transduction in response to DNA damage	TAS	10848581
GO:0042802	Function	Identical protein binding	IPI	19141286
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0051403	Process	Stress-activated MAPK cascade	IDA	8663524, 9218798
GO:0051604	Process	Protein maturation	IDA	32109412
GO:0051726	Process	Regulation of cell cycle	TAS	10848581
GO:0060048	Process	Cardiac muscle contraction	IEA
GO:0060348	Process	Bone development	IEA
GO:0070269	Process	Pyroptotic inflammatory response	IDA	32109412
GO:0071493	Process	Cellular response to UV-B	IDA	35857590
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	29021624
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	TAS
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1904784	Process	NLRP1 inflammasome complex assembly	IDA	22665479

MIM	HGNC	e!Ensembl
601254	6846	ENSG00000108984

P52564

Protein name

Dual specificity mitogen-activated protein kinase kinase 6 (MAP kinase kinase 6) (MAPKK 6) (EC 2.7.12.2) (MAPK/ERK kinase 6) (MEK 6) (Stress-activated protein kinase kinase 3) (SAPK kinase 3) (SAPKK-3) (SAPKK3)

Protein function

Dual specificity protein kinase which acts as an essential component of the MAP kinase signal transduction pathway. With MAP3K3/MKK3, catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinases p38 MAPK11,

PDB

2Y8O , 3ENM , 3FME , 3VN9 , 5ETF , 8A8M , 8P7J , 8PM3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	53 → 314	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 2 is only expressed in skeletal muscle. Isoform 1 is expressed in skeletal muscle, heart, and in lesser extent in liver or pancreas. {ECO:0000269|PubMed:8621675}.

Sequence

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELG
RGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALF
REGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDV
KPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDI
WSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSK
ERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Sequence length

334

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Ovarian serous cystadenocarcinoma	Uncertain significance	rs529602401	RCV005930927

Show/Hide Text Mining Associations (25)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	14695331, 33483588
Breast Neoplasms	Associate	16000313, 19245689, 32977823, 35441810, 35919504
Carcinoma Non Small Cell Lung	Associate	37705754
Chemical and Drug Induced Liver Injury	Associate	32418112
Colonic Neoplasms	Associate	27526785, 29402903
Colorectal Neoplasms	Associate	15037631
Dissection Thoracic Aorta	Associate	29669321
Glioma	Associate	17012236
Inflammation	Associate	14695331, 16230348, 31156213, 40629361
Intervertebral Disc Degeneration	Associate	23661466
Liposarcoma	Associate	31801397
Mitochondrial Diseases	Associate	19245689
Neoplasm Metastasis	Associate	16780590
Neoplasms	Associate	23319048, 35637967
Neoplasms Mesothelial	Associate	14656993
Obesity	Associate	19265796
Ovarian Neoplasms	Associate	28604448
Paralysis	Associate	24737428
Periodontitis	Associate	36214094
Polycystic Ovary Syndrome	Associate	33372369
Prostatic Neoplasms	Associate	20168333
Rhabdomyosarcoma Embryonal	Associate	35801577
Tachycardia Atrioventricular Nodal Reentry	Associate	16780590
Tuberculosis Spinal	Associate	40629361
Urinary Bladder Neoplasms	Associate	16780590

MAP2K6 (mitogen-activated protein kinase kinase 6)