Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3952
Gene name Gene Name - the full gene name approved by the HGNC.	Leptin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LEP
Synonyms (NCBI Gene) Gene synonyms aliases	LEPD, OB, OBS
Disease Acronyms (UniProt) Disease acronyms from UniProt database	LEPD
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q32.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathwa

Show/Hide all(4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894023	C>T	Pathogenic	Missense variant, coding sequence variant
rs201523305	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs724159998	G>A,T	Pathogenic	Coding sequence variant, missense variant
rs1554394014	T>C	Likely-pathogenic	Coding sequence variant, missense variant

Show/Hide all(103)

miRTarBase ID	miRNA	Experiments
MIRT1107446	hsa-miR-1207-3p	CLIP-seq
MIRT1107447	hsa-miR-149	CLIP-seq
MIRT1107448	hsa-miR-155	CLIP-seq
MIRT1107449	hsa-miR-1913	CLIP-seq
MIRT1107450	hsa-miR-1914	CLIP-seq
MIRT1107451	hsa-miR-197	CLIP-seq
MIRT1107452	hsa-miR-2113	CLIP-seq
MIRT1107453	hsa-miR-24	CLIP-seq
MIRT1107454	hsa-miR-298	CLIP-seq
MIRT1107455	hsa-miR-3125	CLIP-seq
MIRT1107456	hsa-miR-3183	CLIP-seq
MIRT1107457	hsa-miR-3187-3p	CLIP-seq
MIRT1107458	hsa-miR-3194-3p	CLIP-seq
MIRT1107459	hsa-miR-324-3p	CLIP-seq
MIRT1107460	hsa-miR-326	CLIP-seq
MIRT1107461	hsa-miR-330-5p	CLIP-seq
MIRT1107462	hsa-miR-3662	CLIP-seq
MIRT1107463	hsa-miR-3678-3p	CLIP-seq
MIRT1107464	hsa-miR-3916	CLIP-seq
MIRT1107465	hsa-miR-3921	CLIP-seq
MIRT1107466	hsa-miR-411	CLIP-seq
MIRT1107467	hsa-miR-4270	CLIP-seq
MIRT1107468	hsa-miR-4284	CLIP-seq
MIRT1107469	hsa-miR-4290	CLIP-seq
MIRT1107470	hsa-miR-4435	CLIP-seq
MIRT1107471	hsa-miR-4441	CLIP-seq
MIRT1107472	hsa-miR-4536	CLIP-seq
MIRT1107473	hsa-miR-4633-5p	CLIP-seq
MIRT1107474	hsa-miR-4653-5p	CLIP-seq
MIRT1107475	hsa-miR-4661-3p	CLIP-seq
MIRT1107476	hsa-miR-4687-3p	CLIP-seq
MIRT1107477	hsa-miR-4695-3p	CLIP-seq
MIRT1107478	hsa-miR-4701-5p	CLIP-seq
MIRT1107479	hsa-miR-4716-5p	CLIP-seq
MIRT1107480	hsa-miR-4723-3p	CLIP-seq
MIRT1107481	hsa-miR-4766-5p	CLIP-seq
MIRT1107482	hsa-miR-4781-3p	CLIP-seq
MIRT1107483	hsa-miR-483-5p	CLIP-seq
MIRT1107484	hsa-miR-498	CLIP-seq
MIRT1107485	hsa-miR-5096	CLIP-seq
MIRT1107486	hsa-miR-532-5p	CLIP-seq
MIRT1107487	hsa-miR-548s	CLIP-seq
MIRT1107488	hsa-miR-588	CLIP-seq
MIRT1107489	hsa-miR-599	CLIP-seq
MIRT1107490	hsa-miR-647	CLIP-seq
MIRT1107491	hsa-miR-659	CLIP-seq
MIRT1107492	hsa-miR-7	CLIP-seq
MIRT1107493	hsa-miR-877	CLIP-seq
MIRT1107494	hsa-miR-9	CLIP-seq
MIRT1107446	hsa-miR-1207-3p	CLIP-seq
MIRT2029684	hsa-miR-1972	CLIP-seq
MIRT1107452	hsa-miR-2113	CLIP-seq
MIRT2029685	hsa-miR-335	CLIP-seq
MIRT2029686	hsa-miR-4264	CLIP-seq
MIRT1107472	hsa-miR-4536	CLIP-seq
MIRT2029687	hsa-miR-4634	CLIP-seq
MIRT2029688	hsa-miR-4650-5p	CLIP-seq
MIRT1107476	hsa-miR-4687-3p	CLIP-seq
MIRT2029689	hsa-miR-4743	CLIP-seq
MIRT2029690	hsa-miR-549	CLIP-seq
MIRT1107489	hsa-miR-599	CLIP-seq
MIRT1107490	hsa-miR-647	CLIP-seq
MIRT1107451	hsa-miR-197	CLIP-seq
MIRT2029684	hsa-miR-1972	CLIP-seq
MIRT1107452	hsa-miR-2113	CLIP-seq
MIRT2260566	hsa-miR-2278	CLIP-seq
MIRT2260567	hsa-miR-23a	CLIP-seq
MIRT2260568	hsa-miR-23b	CLIP-seq
MIRT2260569	hsa-miR-23c	CLIP-seq
MIRT2260570	hsa-miR-3180-5p	CLIP-seq
MIRT2260571	hsa-miR-3189-3p	CLIP-seq
MIRT2260572	hsa-miR-331-3p	CLIP-seq
MIRT2029685	hsa-miR-335	CLIP-seq
MIRT1107466	hsa-miR-411	CLIP-seq
MIRT2029688	hsa-miR-4650-5p	CLIP-seq
MIRT1107479	hsa-miR-4716-5p	CLIP-seq
MIRT2029689	hsa-miR-4743	CLIP-seq
MIRT1107481	hsa-miR-4766-5p	CLIP-seq
MIRT1107482	hsa-miR-4781-3p	CLIP-seq
MIRT1107483	hsa-miR-483-5p	CLIP-seq
MIRT1107485	hsa-miR-5096	CLIP-seq
MIRT2260573	hsa-miR-520a-5p	CLIP-seq
MIRT2260574	hsa-miR-525-5p	CLIP-seq
MIRT2029690	hsa-miR-549	CLIP-seq
MIRT1107489	hsa-miR-599	CLIP-seq
MIRT2029685	hsa-miR-335	CLIP-seq
MIRT2029690	hsa-miR-549	CLIP-seq
MIRT2452924	hsa-miR-1254	CLIP-seq
MIRT2452925	hsa-miR-1276	CLIP-seq
MIRT2452926	hsa-miR-138	CLIP-seq
MIRT2452927	hsa-miR-3116	CLIP-seq
MIRT2452928	hsa-miR-320e	CLIP-seq
MIRT2452929	hsa-miR-3907	CLIP-seq
MIRT2452930	hsa-miR-4254	CLIP-seq
MIRT2452931	hsa-miR-4434	CLIP-seq
MIRT2452932	hsa-miR-4516	CLIP-seq
MIRT2452933	hsa-miR-4531	CLIP-seq
MIRT2452934	hsa-miR-548q	CLIP-seq
MIRT2560591	hsa-miR-1281	CLIP-seq
MIRT2560592	hsa-miR-1915	CLIP-seq
MIRT2560593	hsa-miR-4279	CLIP-seq
MIRT2560594	hsa-miR-4503	CLIP-seq
MIRT2560595	hsa-miR-4726-3p	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
CEBPA	Activation	21983012
HIF1A	Activation	18559540
HIF1A	Unknown	19080496
KHDRBS1	Activation	21672929
SP1	Activation	18559540
STAT3	Activation	18242580;19492417

Show/Hide all(112)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001525	Process	Angiogenesis	IDA	19910644, 21771332
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001666	Process	Response to hypoxia	IEA
GO:0001890	Process	Placenta development	IDA	17957153
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	27037668
GO:0001936	Process	Regulation of endothelial cell proliferation	IDA	11460888
GO:0002021	Process	Response to dietary excess	IEA
GO:0003300	Process	Cardiac muscle hypertrophy	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005179	Function	Hormone activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	ISS
GO:0005829	Component	Cytosol	ISS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0006112	Process	Energy reserve metabolic process	IBA	21873635
GO:0006114	Process	Glycerol biosynthetic process	IEA
GO:0006629	Process	Lipid metabolic process	IBA	21873635
GO:0006635	Process	Fatty acid beta-oxidation	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IBA	21873635
GO:0007565	Process	Female pregnancy	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008206	Process	Bile acid metabolic process	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0008343	Process	Adult feeding behavior	ISS
GO:0010507	Process	Negative regulation of autophagy	IDA	25060689
GO:0010888	Process	Negative regulation of lipid storage	IEA
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IBA	21873635
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IDA	24340098
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	ISS
GO:0014823	Process	Response to activity	IEA
GO:0019953	Process	Sexual reproduction	IMP	8589726
GO:0021954	Process	Central nervous system neuron development	IEA
GO:0030073	Process	Insulin secretion	IEA
GO:0030217	Process	T cell differentiation	ISS
GO:0030300	Process	Regulation of intestinal cholesterol absorption	IEA
GO:0032008	Process	Positive regulation of TOR signaling	IBA	21873635
GO:0032008	Process	Positive regulation of TOR signaling	IDA	25060689
GO:0032099	Process	Negative regulation of appetite	ISS
GO:0032310	Process	Prostaglandin secretion	IDA	19688109
GO:0032355	Process	Response to estradiol	IEA
GO:0032635	Process	Interleukin-6 production	IDA	19688109
GO:0032637	Process	Interleukin-8 production	IDA	19688109
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032814	Process	Regulation of natural killer cell activation	IDA	12504075
GO:0032817	Process	Regulation of natural killer cell proliferation	IDA	12504075
GO:0032868	Process	Response to insulin	IBA	21873635
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0033197	Process	Response to vitamin E	IEA
GO:0033210	Process	Leptin-mediated signaling pathway	ISS
GO:0033686	Process	Positive regulation of luteinizing hormone secretion	IEA
GO:0035360	Process	Positive regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035630	Process	Bone mineralization involved in bone maturation	IEA
GO:0035904	Process	Aorta development	IEA
GO:0038108	Process	Negative regulation of appetite by leptin-mediated signaling pathway	IBA	21873635
GO:0038108	Process	Negative regulation of appetite by leptin-mediated signaling pathway	ISS
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	25060689
GO:0042269	Process	Regulation of natural killer cell mediated cytotoxicity	IDA	12504075
GO:0042307	Process	Positive regulation of protein import into nucleus	IEA
GO:0042445	Process	Hormone metabolic process	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	24340098
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0044320	Process	Cellular response to leptin stimulus	IDA	17344214
GO:0045471	Process	Response to ethanol	IEA
GO:0045765	Process	Regulation of angiogenesis	IDA	11460888
GO:0045906	Process	Negative regulation of vasoconstriction	IEA
GO:0046325	Process	Negative regulation of glucose import	IDA	24340098
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA	21873635
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	17344214
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0046850	Process	Regulation of bone remodeling	ISS
GO:0046881	Process	Positive regulation of follicle-stimulating hormone secretion	IEA
GO:0048639	Process	Positive regulation of developmental growth	IDA	17957153
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0050810	Process	Regulation of steroid biosynthetic process	IEA
GO:0050892	Process	Intestinal absorption	IDA	24340098
GO:0050901	Process	Leukocyte tethering or rolling	IEA
GO:0050999	Process	Regulation of nitric-oxide synthase activity	IDA	15899045
GO:0051428	Function	Peptide hormone receptor binding	IBA	21873635
GO:0051541	Process	Elastin metabolic process	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	17344214
GO:0051897	Process	Positive regulation of protein kinase B signaling	ISS
GO:0060587	Process	Regulation of lipoprotein lipid oxidation	IEA
GO:0060612	Process	Adipose tissue development	IEA
GO:0061037	Process	Negative regulation of cartilage development	IEA
GO:0070093	Process	Negative regulation of glucagon secretion	IEA
GO:0071298	Process	Cellular response to L-ascorbic acid	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0090335	Process	Regulation of brown fat cell differentiation	ISS
GO:0098868	Process	Bone growth	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	27986616
GO:1900015	Process	Regulation of cytokine production involved in inflammatory response	IDA	19688109
GO:1900745	Process	Positive regulation of p38MAPK cascade	IBA	21873635
GO:1900745	Process	Positive regulation of p38MAPK cascade	IDA	24340098
GO:1904651	Process	Positive regulation of fat cell apoptotic process	IEA
GO:1990051	Process	Activation of protein kinase C activity	IBA	21873635
GO:1990051	Process	Activation of protein kinase C activity	IDA	24340098
GO:1990460	Function	Leptin receptor binding	IDA	27037668
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IEA
GO:2000486	Process	Negative regulation of glutamine transport	IEA
GO:2000491	Process	Positive regulation of hepatic stellate cell activation	IEA

MIM	HGNC	e!Ensembl
164160	6553	ENSG00000174697

Protein

UniProt ID

P41159

Protein name

Leptin (Obese protein) (Obesity factor)

Protein function

Key player in the regulation of energy balance and body weight control. Once released into the circulation, has central and peripheral effects by binding LEPR, found in many tissues, which results in the activation of several major signaling pat

PDB

1AX8 , 7Z3Q , 8AVE , 8AVF , 8AVO , 8K6Z , 8X80 , 8X81 , 8X85

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02024	Leptin	23 → 167	Leptin	Domain

Tissue specificity

TISSUE SPECIFICITY: Adipose tissue is the main source of leptin. It is also produced by other peripheral tissues such as the skeletal muscle (PubMed:12448771, PubMed:16052473, PubMed:7789654). Expressed by intercalated and striated tracts of submandibular

Sequence

MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Sequence length

167

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Diabetes	Diabetes	GWAS
Schizophrenia	Schizophrenia	GWAS

Show/Hide Text Mining Associations (452)

Disease Name	Relationship Type	References
Associations from Text Mining
Ablepharon macrostomia syndrome	Associate	26637991
Abortion Habitual	Stimulate	25935494
Abortion Habitual	Associate	38275620
Abortion Spontaneous	Stimulate	25450293
Abortion Spontaneous	Associate	34407095
Acquired Immunodeficiency Syndrome	Associate	9054474
Acromegaly	Associate	28791847
Addison Disease	Associate	37807083
Adenocarcinoma	Associate	25857300, 30257286
Adenocarcinoma Mucinous	Associate	29121911
Adenocarcinoma of Lung	Associate	36782138
Adenoma	Associate	22363123
Adrenal Gland Neoplasms	Associate	29689708
Alopecia Neurologic Defects and Endocrinopathy Syndrome	Associate	15497495
Alzheimer Disease	Associate	21983012, 23895348, 29070909
Alzheimer Disease	Inhibit	24359504, 30775986
Amebiasis	Associate	21393862
Amyotrophic Lateral Sclerosis	Stimulate	30911572
Androgen Insensitivity Syndrome	Associate	32963497
Anemia	Associate	21926355, 37237325
Anhedonia	Associate	27515676
Anorexia	Associate	11511551, 14732844
Anorexia Nervosa	Associate	40015467
Anxiety	Associate	35886710
Aortic Valve Calcification of	Associate	40008515
Aortic Valve Stenosis	Associate	35524481
Apraxia Ideomotor	Associate	30231941
Arteriovenous Fistula	Associate	27134129
Arthritis	Associate	19688109, 25198901
Arthritis Psoriatic	Stimulate	23144698
Arthritis Rheumatoid	Associate	22866899, 36530571, 36759597
Ascites	Associate	26053184
Asthma	Inhibit	19539983
Asthma	Stimulate	22773729, 22837379
Asthma	Associate	27336865, 30203371, 31029506, 31369430, 31580718
Astrocytoma	Stimulate	19775291
Astrocytoma	Associate	30803210
Atherosclerosis	Associate	10731922, 19625677, 20145358, 21074769, 23122912, 23316287, 25573199, 30915774, 31566104, 32798443
Atherosclerosis	Stimulate	14629465
Atrial Fibrillation	Associate	29940585
Atypical Squamous Cells of the Cervix	Associate	30043637
Autoimmune Diseases	Associate	23144698
Bardet Biedl Syndrome	Associate	21209035
Bipolar Disorder	Associate	36077028, 36878995
Blood Platelet Disorders	Associate	11595779
Body Weight	Inhibit	17425664
Body Weight	Associate	21920718
Brain Diseases Metabolic Inborn	Inhibit	18076675
Brain Neoplasms	Associate	19775291, 21771332
Breast Neoplasms	Associate	12379472, 12712467, 16504019, 17344214, 18408141, 18559540, 18945363, 19017403, 19047149, 19662684, 19697123, 20569445, 21163886, 21239736, 21516303 View all (43 more)
Breast Neoplasms	Stimulate	14985328, 16533767, 20032412, 22270359
Breast Neoplasms	Inhibit	27177292, 31292496
Bulimia	Associate	16570705
Bulimia Nervosa	Associate	40015467
Calcinosis	Associate	34093426
Calcinosis Cutis	Associate	23558862
Carcinogenesis	Associate	15300888, 17072067, 18958356, 25027400, 26147886, 26593227, 27345723, 27480179, 27842582, 29370782, 30379922, 33587254
Carcinogenesis	Stimulate	32471192
Carcinoma Hepatocellular	Associate	15300888, 16565221, 18473418, 20723213
Carcinoma Hepatocellular	Stimulate	26982332
Carcinoma Hepatocellular	Inhibit	33369452
Carcinoma Non Small Cell Lung	Associate	24142645, 24460967, 31119158
Carcinoma Ovarian Epithelial	Associate	15890779, 19765303, 23551967
Carcinoma Pancreatic Ductal	Associate	39298063
Carcinoma Renal Cell	Associate	18787400, 33804101
Cardiomyopathy Dilated	Associate	22764185
Cardiovascular Diseases	Associate	14629465, 19584182, 20460359, 21244662, 22185674, 22217186, 24051404, 27310420, 28077136, 30983550, 31872802, 32125188, 32753620, 36958975, 39354608
Carotid Artery Diseases	Associate	23316287, 30915774
Carotid Stenosis	Associate	23316287
Cartilage Diseases	Associate	17350295
Cell Transformation Neoplastic	Associate	28729467
Chemical and Drug Induced Liver Injury	Associate	17505564
Cholelithiasis	Associate	33893772
Cholestasis Intrahepatic	Associate	33893772
Chondrosarcoma	Associate	27345723
Chronic Disease	Associate	16734391, 19057526, 27622441, 29596446
Chronic Periodontitis	Associate	31038568, 33967621
Ciliary Motility Disorders	Associate	21209035
Ciliopathies	Stimulate	21209035
Cognition Disorders	Inhibit	24359504
Cognitive Dysfunction	Associate	23799059, 30775986
Cognitive Dysfunction	Inhibit	24359504
Cognitive Dysfunction	Stimulate	27515676
Cold Injury	Associate	23529020
Colitis Ulcerative	Stimulate	14732844, 23211301
Colonic Neoplasms	Associate	30142858
Colorectal Neoplasms	Associate	17591803, 18059035, 21166956, 21263187, 22363134, 23558862, 23593308, 24073224, 27460082, 30379922, 31021558, 31506433, 32053666, 32596369, 34497681, 34876290, 36981858, 37282602 View all (3 more)
Colorectal Neoplasms	Stimulate	17660334, 30142858
Colorectal Neoplasms	Inhibit	27842582
Communicable Diseases	Associate	14734764
Communicable Diseases	Stimulate	23211301
Compassion Fatigue	Associate	21943151
Consciousness Disorders	Associate	26674634
Constriction Pathologic	Associate	18349107
Constriction Pathologic	Stimulate	31872802
Conversion Disorder	Associate	27515676
Coronary Aneurysm	Associate	27151106
Coronary Artery Disease	Stimulate	10447228, 33735200
Coronary Artery Disease	Associate	18160586, 20145358, 21176905, 21498926, 27151106, 31872802, 32049202
Coronary Disease	Associate	18712185, 19473179, 29121163
Coronary Restenosis	Stimulate	18349107
Coronary Stenosis	Stimulate	31872802
COVID 19	Associate	32512493, 33404078
COVID 19	Stimulate	37246981
Craniopharyngioma	Associate	37509115
Crohn Disease	Stimulate	14732844
Crohn Disease	Associate	23168838, 31822667, 33105684
Cystic Fibrosis	Inhibit	31582896
Cytokine Release Syndrome	Associate	14632752
Death	Associate	21943151, 34309635
Delayed Emergence from Anesthesia	Associate	16322796, 21042325
Depressive Disorder	Associate	25629253, 28316984
Depressive Disorder Major	Associate	35039097
Dermatitis Atopic	Stimulate	17634954
Dermatitis Atopic 3	Stimulate	17634954
Diabetes Gestational	Stimulate	16343040, 18696355, 24262292, 28361552, 28942694, 30020508, 36432399
Diabetes Gestational	Associate	24954653, 26584065, 27034205, 28050671, 28363002, 28666334, 28846666, 36128550, 36849131
Diabetes Mellitus	Associate	10022436, 12006634, 12270921, 12690081, 15070752, 17135604, 18263705, 20167575, 21340154, 22185674, 28256392, 28363002, 32544194, 34937509, 37241229, 38127688 View all (1 more)
Diabetes Mellitus	Stimulate	19121992, 31533725
Diabetes Mellitus	Inhibit	21549702
Diabetes Mellitus Type 1	Associate	24304572, 28260466, 36218419, 37170809
Diabetes Mellitus Type 2	Associate	10947884, 12690081, 15070752, 15189365, 21465273, 21709297, 22491740, 24051404, 24102053, 24549597, 26338087, 26829555, 27134129, 27705028, 28413567 View all (13 more)
Diabetes Mellitus Type 2	Stimulate	25306890
Diabetic Cardiomyopathies	Associate	26614846
Diarrhea	Associate	29358881
Disease Resistance	Associate	36512575
Disruptive Impulse Control and Conduct Disorders	Associate	34097736
Diverticulum	Associate	24740401
Donohue Syndrome	Associate	34718628
Down Syndrome	Inhibit	10368796
Down Syndrome	Associate	34545294
Drug Hypersensitivity	Associate	17634954
Drug Hypersensitivity	Stimulate	23383125
Drug Related Side Effects and Adverse Reactions	Associate	19763737
Drug Related Side Effects and Adverse Reactions	Inhibit	25967962, 27863383
Dwarfism Pituitary	Associate	20016047, 26915772, 27649665, 33762520
Dyslipidemias	Associate	18769731, 31000363
Embolism Fat	Inhibit	22411388
Endometrial Neoplasms	Associate	19154413, 22038736, 25171477, 25811593, 28659656, 32531934
Endometriosis	Associate	17255327, 18958774, 26242176
Endotoxemia	Inhibit	30422702
Enteritis	Associate	33524399
Epileptic Syndromes	Associate	10447228
Epiphyseal dysplasia multiple 1	Associate	24982243
Erythema elevatum diutinum	Associate	24982243
Essential Hypertension	Associate	22218754, 24171506
Fatigue	Associate	37542585
Fatty Liver	Associate	17505564, 22171144, 22215535, 31842467, 35549673
Fatty Liver	Inhibit	35677722
Feeding and Eating Disorders	Associate	16570705, 23115175, 24415571, 36241774, 40015467
Femoral Neck Fractures	Stimulate	29908226
Fetal Diseases	Associate	24304572
Fetal Growth Retardation	Associate	18000344, 22971074, 31041507, 35090410, 36128550
Fibrocartilaginous embolism	Associate	24441571
Fibromyalgia	Associate	32582603
Fibrosis	Associate	17540037, 24982243, 29436483
Fistula	Associate	27134129
Food Addiction	Associate	22647300
Frailty	Associate	26258797
Frontotemporal Dementia	Associate	24415571
Gallbladder Diseases	Associate	33893772
Gastroesophageal Reflux	Associate	24569475
Genee Wiedemann syndrome	Stimulate	33218077
Gestational Trophoblastic Disease	Associate	23089140
Glioblastoma	Associate	19775291, 21771332, 30803210, 32526957
Glioma	Associate	30803210
Glucose Intolerance	Associate	20724651
Glucose Metabolism Disorders	Associate	20724651, 25929254
Glycosuria Renal	Associate	20016047
Graves Ophthalmopathy	Associate	14764816, 15886250
Head and Neck Neoplasms	Associate	26747525
Heart Diseases	Stimulate	22764185
Heart Diseases	Associate	26338087
Heart Failure	Stimulate	12559213, 29784904
Heart Failure	Associate	19919993, 22764185, 29907861, 30006491
Helicobacter Infections	Stimulate	11511551
Helicobacter Infections	Associate	15655824
HELLP Syndrome	Associate	20149225, 20541258
HELLP Syndrome	Stimulate	25583406
Hematuria Benign Familial	Associate	17006991
Hemihyperplasia Isolated	Associate	32968152
Hemochromatosis	Associate	25985182
Hemolysis	Associate	20149225
Hemolytic Uremic Syndrome	Inhibit	23058473, 23418565
Hemophilia A	Stimulate	30650445
Hepatitis C	Associate	22171144
Hepatitis C Chronic	Associate	16489668, 17540037, 22171144
Hepatitis Viral Human	Associate	17060687, 17540037
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19697123, 21239736, 23228483, 24377502, 27177292, 33019728
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	28270386
HIV Infections	Associate	14632752, 21926355, 26756119, 27690695
Hyperglycemia	Associate	25800063, 27340502, 31947745, 35334523
Hyperinsulinism	Associate	10022436, 18559540, 18769731
Hyperinsulinism	Stimulate	25306890
Hyperphagia	Associate	26186301, 29217499, 29950524, 40246357
Hyperphagia	Inhibit	29217499, 31067764
Hyperplasia	Associate	27134129
Hypertension	Associate	15340103, 18769731, 19204185, 19562039, 19772655, 21465273, 21918574, 21920718, 22218754, 24171506, 24485307, 26694100, 29338791, 36157437
Hypertension	Stimulate	16785148, 23535989
Hypertension Pregnancy Induced	Associate	22713493
Hyperthyroidism	Associate	37876543
Hypertrophy	Associate	29436483
Hypertrophy Left Ventricular	Associate	24485307
Hyperuricemia	Stimulate	12238635
Hypoalphalipoproteinemias	Associate	40128964
hypoglycemic encephalopathy	Associate	18854428
Hypogonadism	Associate	15070752, 18854428, 21340154, 26336809
Hypoplastic Left Heart Syndrome	Associate	26278057
Hypotension	Associate	31357197
Hypoxia	Stimulate	16533767, 17591803, 17609976, 18696355, 21448846, 25312721, 25573199, 25889814, 36530571
Hypoxia	Associate	17049073, 20569445, 22866899, 30257286, 31935962
Hypoxia Brain	Stimulate	17255327
Hypoxia Brain	Associate	20569445
Ichthyosis Bullosa of Siemens	Associate	30622656
Idiopathic Noncirrhotic Portal Hypertension	Inhibit	33369452
Immune System Diseases	Associate	29950524
Infections	Associate	17497033, 21943151, 24360890, 34846723
Infertility	Associate	18958774, 30231941, 34407095
Infertility Male	Associate	27813378
Inflammation	Associate	10731922, 11511551, 12690081, 14732844, 15232612, 15655824, 16135719, 16412224, 17350295, 17425664, 17634954, 18059035, 18547319, 18624749, 19688109 View all (41 more)
Inflammation	Stimulate	11591788, 18829234, 23383125, 26276826, 28250190, 29436483, 29550824, 31831137, 32820432, 35326405, 35524481, 36771423
Inflammation	Inhibit	34299256, 36142638
Inflammatory Bowel Diseases	Associate	14732844, 33159578
Influenza Human	Associate	24360890
Insulin Resistance	Associate	11591788, 18854428, 20711963, 21340154, 21918574, 21920718, 23349940, 23593308, 26420861, 27034205, 27515676, 28027637, 28542631, 28758947, 31914480 View all (6 more)
Insulin Resistance	Stimulate	22491740, 25306890
Insulin Resistance	Inhibit	27342408
Insulinoma	Associate	18263705
Intervertebral Disc Degeneration	Associate	23335226, 31408735, 36293132
Intervertebral disc disease	Associate	24441571
Intestinal Diseases	Associate	16437696
Intracranial Embolism	Associate	23316287
Intrahepatic Cholestasis of Pregnancy	Associate	35643225
Irritable Bowel Syndrome	Stimulate	29358881
Ischemia	Stimulate	25583406
Ischemic Attack Transient	Associate	21176905
Juvenile gout	Stimulate	12238635
Kidney Diseases	Associate	20140086, 31566104
Kidney Failure Chronic	Associate	20140086, 27134129, 9767543
Kidney Neoplasms	Stimulate	18787400
Klinefelter Syndrome	Associate	28369266
Labor Pain	Associate	35031012
Leiomyoma	Associate	35598777, 36771423
Leprosy	Associate	37327675
Leukemia	Associate	17072067
Leukemia Myeloid	Associate	10029596
Leukemia Myeloid Acute	Associate	10029596, 33485366, 37237325
Leukemia Myeloid Acute	Inhibit	17072067
Leukemia T Cell	Associate	9722301
Leydig Cell Tumor	Stimulate	32455738
Lipedema	Associate	32059474
Lipodystrophy	Inhibit	20616664
Lipodystrophy	Associate	26336809, 35524481, 35733784
Lipodystrophy Congenital Generalized	Inhibit	18076675, 18640396
Lipodystrophy Congenital Generalized	Associate	23362058, 31822667, 34213454, 37347108
Lipodystrophy Familial Partial	Associate	18076675
Lipodystrophy Familial Partial	Inhibit	34168618
Lipomatosis	Stimulate	34187516
Liver Diseases	Associate	17060687
Liver Diseases Alcoholic	Associate	24259947
Liver Failure	Associate	24259947
Lown Ganong Levine Syndrome	Associate	33864589
Lumbar Stenosis Familial	Stimulate	29436483
Lung Injury	Associate	25027400
Lung Neoplasms	Associate	25027400, 35225464
Lung Neoplasms	Stimulate	26593227
Lupus Erythematosus Systemic	Inhibit	19811274
Lupus Erythematosus Systemic	Associate	25989537, 26385092, 28244652, 34646335
Lupus Nephritis	Associate	25345756
Lymphatic Metastasis	Associate	17006991, 30142858, 32363657
Lymphatic Metastasis	Stimulate	24548863, 25171477, 36941557
Lymphedema	Associate	27366905
Lymphoma B Cell	Associate	22666399
Lymphoma B Cell	Stimulate	22666399
Lymphoma Follicular	Associate	16160698
Lymphoma Large B Cell Diffuse	Associate	32986381
Lymphoma Non Hodgkin	Associate	16160698
Malformations of Cortical Development Group I	Associate	28381165
Malnutrition	Associate	17355247
Mammary Neoplasms Animal	Associate	21673435, 25967962
MASS syndrome	Associate	26064921, 26886906
MASS syndrome	Inhibit	29907861
Mastocytosis Systemic	Associate	26095599
Melanoma	Inhibit	37481560
Mental Disorders	Associate	16322796, 31566104
Metabolic Diseases	Inhibit	18076675
Metabolic Diseases	Associate	20711963, 21852675, 22545089, 24498038, 26504811, 27101398, 31067764, 32936762, 34407095, 35436409, 36834493, 39354608
Metabolic Syndrome	Stimulate	21498926, 36597718
Metabolic Syndrome	Associate	21918574, 22185674, 22217186, 22734460, 27310420, 27681143, 27966294, 28077136, 30356143, 34016094, 34205732, 35627229, 36117520, 37171229, 39837875
Metrorrhagia	Inhibit	35238278
Mitochondrial Diseases	Associate	19763737
Mitochondrial Diseases	Inhibit	37542585
Mitral Valve Insufficiency	Inhibit	38141725
Multiple Myeloma	Stimulate	24841155
Multiple Myeloma	Associate	27863383
Multiple Sclerosis	Associate	24098530
Multiple Sclerosis Chronic Progressive	Stimulate	24098530
Muscular Dystrophy Duchenne	Associate	16734391
Myelodysplastic Syndromes	Associate	37237325
Myocardial Infarction	Associate	21176905, 24549597
Myocardial Ischemia	Associate	19919993
Myopathy with Lactic Acidosis Hereditary	Associate	12559213
Myotonic Dystrophy	Associate	24549597, 32544194
Myotonic Dystrophy	Stimulate	32933141
Nasopharyngeal Carcinoma	Associate	35628510, 35778755
Neoplasm Metastasis	Stimulate	17006991, 31659105, 32836215
Neoplasm Metastasis	Associate	21163886, 22270359, 23558862, 28542577, 30142858, 32363657, 35628510
Neoplasms	Associate	14985328, 16504019, 17006991, 17660334, 18408141, 18945363, 19697123, 19765303, 19775291, 20569445, 21045260, 21263187, 22282662, 23564622, 24569475 View all (47 more)
Neoplasms	Inhibit	21245862, 26390898, 33067778, 37481560
Neoplasms Adipose Tissue	Associate	16467597, 18616661, 19238140, 19584182, 20711963, 21512510, 21920718, 24947733, 26064921, 27648968, 27933755, 28077136, 28414270, 30425339, 31851703 View all (11 more)
Neoplastic Syndromes Hereditary	Associate	9385617
Nerve Degeneration	Associate	36907275
Neural Tube Defects	Associate	23132673
Neuroblastoma	Associate	21983012
Neurodegenerative Diseases	Associate	30911572
Neurologic Manifestations	Associate	28729389
Neurotoxicity Syndromes	Associate	36907275
Niemann Pick Disease Type C	Associate	35778755
Non alcoholic Fatty Liver Disease	Associate	22215535, 24716593, 31659105, 35677722
Non alcoholic Fatty Liver Disease	Inhibit	37400922
Obesity	Associate	10022436, 10029596, 10348493, 10368796, 10388699, 10834292, 10919945, 11171593, 11591788, 11595779, 11786597, 12270921, 12634434, 12690081, 14734764 View all (265 more)
Obesity	Stimulate	10385485, 14629465, 14985328, 17425664, 18787400, 19047149, 20032412, 20711963, 22217186, 22773729, 24262292, 24885899, 25186264, 25967962, 26513002 View all (26 more)
Obesity	Inhibit	16322796, 28729389, 36131285, 36512575, 36849131
Obesity Abdominal	Stimulate	26808524
Obesity Abdominal	Associate	28738359, 31914480, 36619235
Obesity Maternal	Associate	24954653, 25322273, 25547282, 32004678
Obesity Maternal	Inhibit	30732639
Obesity Metabolically Benign	Associate	26504811, 34659828
Obesity Morbid	Associate	15070752, 18854428, 21340154, 22734460, 28377240, 31067764, 36619235
Obesity Morbid	Stimulate	37266430
Organizing Pneumonia	Associate	27310420
Ossification of Posterior Longitudinal Ligament	Associate	17702747
Osteoarthritis	Stimulate	17350295, 25893833, 26318657, 29908226, 31878053
Osteoarthritis	Associate	17502362, 19215023, 19688109, 20141628, 20534145, 25312721, 26636769, 27716396, 32095874, 37171229
Osteoarthritis Knee	Associate	34983993
Osteoporosis	Associate	19215023, 34818977, 35758378
Ovarian Diseases	Associate	23579009
Ovarian Neoplasms	Associate	18624749, 22968658, 26053184, 28075407, 29976638, 34884678, 37155466
Overweight	Associate	17951471, 18547319, 21631924, 25423261, 25450293, 27622441, 28686191, 30746959, 31285522, 31661820, 31872802, 31996075, 32398726, 33404078, 35549673, 35886710, 36981858, 8954050 View all (3 more)
Overweight	Stimulate	18654948, 20363117, 22773729, 23318644, 26053184
Pain	Associate	26674634
Pancreatic Neoplasms	Associate	19051043, 25408239, 27780823, 37555827
Pdgfrb Associated Chronic Eosinophilic Leukemia	Associate	37237325
Periapical Granuloma	Associate	25662559
Pericarditis	Associate	28244652
Periodontal Diseases	Associate	39337647
Periodontitis	Inhibit	33967621
Peripheral Nervous System Diseases	Associate	36741233
Peritoneal Fibrosis	Associate	23418565
Peritonitis	Associate	21943151
Pneumonia	Stimulate	25662559
Pneumonia Lipid	Associate	30208589
Polycystic Ovary Syndrome	Associate	15497495, 16570705, 21827375, 25423261, 25450293, 30635060, 32283997, 32393090, 33914321, 34407095, 35185786, 35758378, 39692030
Polycystic Ovary Syndrome	Stimulate	20500101, 26589977
Post Acute COVID 19 Syndrome	Stimulate	37753077
Prader Willi Syndrome	Associate	10368796, 10385485, 18198805, 37430349
Prader Willi Syndrome	Inhibit	9450849
Pre Eclampsia	Associate	17071538, 20149225, 20204130, 20541258, 22713493, 23544093, 27690695, 32497025, 34937509, 35104295, 36914823, 37949031, 38166707, 38275620
Pre Eclampsia	Stimulate	18000344, 18696355
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	17072067
Preeclamptic toxemia	Stimulate	18696355
Pregnancy Complications	Associate	38275620
Premature Birth	Stimulate	25583406
Premature Birth	Associate	38275620
Progeria	Associate	35524481
Prostatic Hyperplasia	Associate	18958356
Prostatic Neoplasms	Associate	12902351, 18958356, 19035456, 30186533, 31671654, 32894540, 34218595
Prostatic Neoplasms	Inhibit	19035456, 35710817
Prostatic Neoplasms	Stimulate	21045260, 32573960
Prostatitis	Associate	19035456, 21045260, 25351156, 34218595
Protein Energy Malnutrition	Associate	38017491
Psoriasis	Associate	18547319, 24851032, 33416099
Psoriasis	Inhibit	26095599
Pulmonary Arterial Hypertension	Associate	36157437, 40073405
Pulmonary Disease Chronic Obstructive	Associate	16135719, 22773729, 22837379, 22881231, 31308239, 37812260
Purpura Thrombocytopenic Idiopathic	Associate	34299256
Renal Insufficiency	Inhibit	22265003
Renal Insufficiency	Stimulate	25935494
Renal Insufficiency	Associate	27134129
Renal Insufficiency Chronic	Associate	20140086, 23058473, 38017491
Respiratory Distress Syndrome	Associate	27095254
Respiratory System Abnormalities	Associate	21920718
Retinal Dysplasia	Associate	22363123
Retinal Vein Occlusion	Associate	25978399
Rheumatic Diseases	Associate	19434061, 20141628
Rhinitis Allergic	Associate	30951821, 32963497
Rupture	Stimulate	23122912
Sarcoidosis	Associate	26368286
Schaaf Yang syndrome	Associate	34128869
Schizophrenia	Associate	35627229
Scleroderma Limited	Associate	27515676
Scleroderma Systemic	Associate	31667578
Scoliosis	Associate	36670417
Sepsis	Associate	21943151
Severe Acute Respiratory Syndrome	Associate	27095254
Severe Acute Respiratory Syndrome	Stimulate	37949031
Sleep Apnea Central	Associate	24030529
Sleep Apnea Obstructive	Associate	18204169, 32968152, 38172514
Sleep Apnea Syndromes	Associate	23609427
Sleep Wake Disorders	Associate	21386998
Smooth Muscle Tumor	Associate	34093426
Soft Tissue Injuries	Associate	21465273
Squamous Cell Carcinoma of Head and Neck	Associate	25809704, 26015646
Status Asthmaticus	Stimulate	25186264, 30203371, 31580718
Stiff Skin Syndrome	Associate	27151106
Stiff Skin Syndrome	Inhibit	29907861
Stomach Diseases	Associate	17006991
Stomach Neoplasms	Associate	16437696, 17006991, 24569475, 26147886, 28316984, 35866593
Stomach Neoplasms	Stimulate	24548863
Stroke	Associate	19473179
Substance Related Disorders	Associate	22647300, 23115175
Syndrome	Inhibit	20362964
Syndrome	Associate	25367549
Syphilis	Associate	31186010
Takayasu Arteritis	Associate	31595672
Tarlov Cysts	Associate	34970222
Tertiary Lymphoid Structures	Associate	29121911, 32596369
Thinness	Inhibit	22881231
Thinness	Associate	40015467
Thrombocytopenia	Associate	34299256
Thrombosis	Stimulate	15869602
Thrombosis	Associate	15869602
Thyroid Cancer Papillary	Associate	30657911
Thyroid Cancer Papillary	Inhibit	33587254
Thyroid Diseases	Associate	37432370
Thyroid Neoplasms	Associate	33587254
Thyroid Nodule	Stimulate	28791847
Thyroiditis	Associate	30657911
Tooth Mobility	Associate	27515676
Tooth Resorption	Associate	16734391
Triple Negative Breast Neoplasms	Associate	32471192, 37489486
Tuberculosis	Associate	24589429, 26368286
Tuberculosis Meningeal	Inhibit	17497033, 32265833
Tuberculosis Pulmonary	Inhibit	17497033
Tuberculosis Pulmonary	Associate	24589429, 30182920
Uremia	Associate	23058473, 9186891
Urinary Bladder Neoplasms	Associate	32363657, 34229569, 37892180
Vascular Calcification	Associate	34093426
Vascular Diseases	Associate	14629465, 23856194, 25448795, 26278057, 35837388
Vascular Ring	Associate	29436483
Vascular System Injuries	Inhibit	20016047
Venous Thromboembolism	Associate	34309635
Venous Thrombosis	Associate	17425664
Ventricular Dysfunction Left	Associate	29907861
Ventricular Dysfunction Left	Stimulate	31533725
Virus Diseases	Associate	17060687
Wasting Syndrome	Associate	9054474
Weight Gain	Associate	11511551, 12634434, 22730441, 23799528, 26374448, 33524399, 35549673, 35574020, 36980961
Weight Gain	Stimulate	37509115
Weight Loss	Stimulate	12634434, 16571851, 23378611, 26186301
Weight Loss	Inhibit	14629465, 18356846, 20383037, 23341572, 24634403
Weight Loss	Associate	15070752, 16322796, 21042325, 21386998, 21917907, 21931275, 24141897, 25132099, 26637991, 28797697, 29234017, 29920214, 31357197, 32071117, 39354608

LEP (leptin)