Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3929
Gene name Gene Name - the full gene name approved by the HGNC.	Lipopolysaccharide binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LBP
Synonyms (NCBI Gene) Gene synonyms aliases	BPIFD2
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q11.23
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeab

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017289	hsa-miR-335-5p	Microarray	18185580
MIRT050450	hsa-miR-22-3p	CLASH	23622248
MIRT045133	hsa-miR-186-5p	CLASH	23622248
MIRT1105367	hsa-miR-4299	CLIP-seq
MIRT1105368	hsa-miR-4709-3p	CLIP-seq
MIRT1105369	hsa-miR-501-3p	CLIP-seq
MIRT1105370	hsa-miR-502-3p	CLIP-seq
MIRT1105371	hsa-miR-765	CLIP-seq
MIRT2560303	hsa-miR-1207-3p	CLIP-seq
MIRT2560304	hsa-miR-139-3p	CLIP-seq
MIRT2560305	hsa-miR-4267	CLIP-seq
MIRT2560306	hsa-miR-875-3p	CLIP-seq
MIRT2560303	hsa-miR-1207-3p	CLIP-seq
MIRT2560304	hsa-miR-139-3p	CLIP-seq
MIRT2683800	hsa-miR-3655	CLIP-seq
MIRT2560305	hsa-miR-4267	CLIP-seq
MIRT2683801	hsa-miR-578	CLIP-seq
MIRT2560306	hsa-miR-875-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
JUN	Repression	15114678

Show/Hide all(58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IBA	21873635
GO:0001530	Function	Lipopolysaccharide binding	IDA	12594207
GO:0001530	Function	Lipopolysaccharide binding	IMP	24120359
GO:0001530	Function	Lipopolysaccharide binding	ISS	2477488
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IEA
GO:0002281	Process	Macrophage activation involved in immune response	IBA	21873635
GO:0002281	Process	Macrophage activation involved in immune response	IMP	24120359
GO:0002281	Process	Macrophage activation involved in immune response	ISS	2402637
GO:0005102	Function	Signaling receptor binding	ISS	2477488
GO:0005515	Function	Protein binding	IPI	15294986, 21988832, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	2402637, 11528597, 24120359
GO:0005615	Component	Extracellular space	ISS	2477488
GO:0006953	Process	Acute-phase response	IBA	21873635
GO:0006953	Process	Acute-phase response	IEP	12932360
GO:0006953	Process	Acute-phase response	ISS	2477488
GO:0006968	Process	Cellular defense response	ISS	2402637
GO:0008228	Process	Opsonization	IC	12932360
GO:0008228	Process	Opsonization	ISS	2477488
GO:0009986	Component	Cell surface	IDA	11528597
GO:0015920	Process	Lipopolysaccharide transport	IDA	8985160
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IBA	21873635
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	8409400, 11739189
GO:0032490	Process	Detection of molecule of bacterial origin	IDA	11528597
GO:0032496	Process	Response to lipopolysaccharide	IDA	8409400, 11739189
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	11739189
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	8409400
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	8409400
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IDA	8409400, 12594207
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	24120359
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS	2402637
GO:0033036	Process	Macromolecule localization	IDA	15294986
GO:0034142	Process	Toll-like receptor 4 signaling pathway	TAS
GO:0034145	Process	Positive regulation of toll-like receptor 4 signaling pathway	IDA	11528597
GO:0043032	Process	Positive regulation of macrophage activation	IBA	21873635
GO:0043032	Process	Positive regulation of macrophage activation	IDA	8409400
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0045087	Process	Innate immune response	IC	12932360
GO:0045087	Process	Innate immune response	ISS	2477488
GO:0045919	Process	Positive regulation of cytolysis	IDA	15294986
GO:0050829	Process	Defense response to Gram-negative bacterium	IBA	21873635
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	11528597
GO:0050829	Process	Defense response to Gram-negative bacterium	ISS	2402637
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA	21873635
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12932360
GO:0060265	Process	Positive regulation of respiratory burst involved in inflammatory response	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070891	Function	Lipoteichoic acid binding	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	12594207
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	24120359
GO:0071223	Process	Cellular response to lipoteichoic acid	IDA	12594207
GO:0071723	Function	Lipopeptide binding	IDA	15294986
GO:0090023	Process	Positive regulation of neutrophil chemotaxis	IEA

MIM	HGNC	e!Ensembl
151990	6517	ENSG00000129988

Protein

UniProt ID

P18428

Protein name

Lipopolysaccharide-binding protein (LBP)

Protein function

Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria (PubMed:24120359, PubMed:7517398). Acts as an affinity enhan

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01273	LBP_BPI_CETP	38 → 212	LBP / BPI / CETP family, N-terminal domain	Family
PF02886	LBP_BPI_CETP_C	241 → 478	LBP / BPI / CETP family, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in blood serum (at protein level). {ECO:0000269|PubMed:2402637, ECO:0000269|PubMed:24120359}.

Sequence

MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLP
DFTGDLRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRK
SFFKLQGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNL
FHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSFADIDYSLVEAPRATA
QMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLN
FSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDP
YMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFN
AELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMR
V

Sequence length

481

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Diabetes	Diabetes			GWAS

Show/Hide Text Mining Associations (88)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Inhibit	28851981
Acute Aortic Syndrome	Associate	32256857
Amyotrophic Lateral Sclerosis	Stimulate	37350306
Arthritis Rheumatoid	Associate	32404914, 34458379
Ascites	Stimulate	27112233
Asthma	Associate	37438758
Attention Deficit Disorder with Hyperactivity	Stimulate	37199526
Autism Spectrum Disorder	Stimulate	37199526
Axial Spondyloarthritis	Stimulate	34560894
Bacteremia	Associate	18056482
Bacterial Infections	Associate	24107515
Carcinoma Hepatocellular	Associate	10091598, 34722779, 36002595
Carcinoma Non Small Cell Lung	Associate	29573061
Cardiovascular Diseases	Associate	32327445
Colorectal Neoplasms	Associate	21633598, 32375704
Communication Disorders	Associate	36859478
Coronary Artery Disease	Associate	34571843
Coronary Stenosis	Associate	32327445
COVID 19	Associate	34232570, 35212063
Crohn Disease	Associate	21334452
Death	Associate	18056482
Diabetes Mellitus	Stimulate	23704966
Diabetes Mellitus	Associate	32327445
Diabetes Mellitus Type 2	Associate	28851981, 34161346
Diabetic Foot	Stimulate	35068329
Dysbiosis	Associate	26539989
Encephalitis	Associate	32973805
Fatigue Syndrome Chronic	Stimulate	27338587
Fetal Growth Retardation	Associate	38069155
Fibrosis	Stimulate	23446058
Glut1 Deficiency Syndrome	Associate	36462169
Gram Negative Bacterial Infections	Associate	18056482
Graves Ophthalmopathy	Stimulate	38107520
Growth Disorders	Associate	31482782
Hepatitis B Chronic	Associate	36002595
Infections	Associate	15240728, 31269910
Inflammation	Associate	27198191, 29378051, 31269910, 31425383, 32903610, 34491886, 38107520, 7510687
Insulin Resistance	Associate	26799617
Lung Neoplasms	Associate	40155834
Metabolic Diseases	Associate	26799617
Metabolic Syndrome	Associate	23349936
Mood Disorders	Associate	36462169
Mucocutaneous Lymph Node Syndrome	Associate	28262744
Myocardial Infarction	Associate	32736138
Non alcoholic Fatty Liver Disease	Associate	34491886
Non ST Elevated Myocardial Infarction	Associate	32736138
Obesity	Associate	23349936
Obesity	Stimulate	23704966
Obesity Abdominal	Associate	23349936
Overweight	Stimulate	23349936
Pancreatitis	Associate	16875458
Pancreatitis	Stimulate	31314190
Paratuberculosis	Associate	21334452
Parkinson Disease	Inhibit	26539989
Periodontitis	Associate	27531006
Periprosthetic Fractures	Associate	35306116
Pneumonia	Associate	22337588
Polycystic Ovary Syndrome	Stimulate	26799617
Post Acute COVID 19 Syndrome	Inhibit	37047497
Premature Birth	Stimulate	35130326
Pulmonary Disease Chronic Obstructive	Stimulate	34113087
Respiratory Insufficiency	Stimulate	35212063
Respiratory Tract Diseases	Associate	32780727
Retinal Vein Occlusion	Stimulate	33270842
Retinal Vein Occlusion	Associate	36820679
Sarcoidosis	Associate	35294531
Schizophrenia	Associate	33632634
Sepsis	Stimulate	16875458
Severe Acute Respiratory Syndrome	Associate	36462169
Shock Septic	Associate	15114678
Spinal Cord Injuries	Associate	33451043
ST Elevation Myocardial Infarction	Associate	39513871
Stomach Neoplasms	Associate	35299682, 35936362
Stomach Neoplasms	Stimulate	40155834
Systemic Inflammatory Response Syndrome	Stimulate	16875458
Takotsubo Cardiomyopathy	Associate	39513871
Thrombophilia	Inhibit	28851981
Tuberculosis	Associate	28794177
Tuberculosis	Stimulate	33841412
Tuberculosis Extrapulmonary	Inhibit	23486418
Tuberculosis Pulmonary	Inhibit	23486418
Tuberculosis Pulmonary	Associate	36787336
Uterine Cervical Diseases	Associate	35130326
Venous Thromboembolism	Associate	35426199
Venous Thrombosis	Stimulate	35426199
Wheat Hypersensitivity	Stimulate	27459152
Winter Shortland Temple syndrome	Associate	29367348
Wounds and Injuries	Associate	16875458

LBP (lipopolysaccharide binding protein)