Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	3776
Gene name	Potassium two pore domain channel subfamily K member 2
Gene symbol	KCNK2
Synonyms (NCBI Gene)	K2p2.1TPKC1TREKTREK-1TREK1hTREK-1chTREK-1e
Chromosome	1
Chromosome location	1q41
Summary	This gene encodes one of the members of the two-pore-domain background potassium channel protein family. This type of potassium channel is formed by two homodimers that create a channel that leaks potassium out of the cell to control resting membrane pote

186

Show/Hide all (186)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022916	hsa-miR-124-3p	Microarray	18668037
MIRT642058	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT642057	hsa-miR-3682-3p	HITS-CLIP	23824327
MIRT642054	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT642055	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT642059	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT642057	hsa-miR-3682-3p	HITS-CLIP	23824327
MIRT642056	hsa-miR-4284	HITS-CLIP	23824327
MIRT642054	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT642055	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT642059	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT642058	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT642057	hsa-miR-3682-3p	HITS-CLIP	23824327
MIRT642056	hsa-miR-4284	HITS-CLIP	23824327
MIRT642054	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT642055	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT739499	hsa-miR-4760-5p	HITS-CLIP	27418678
MIRT739499	hsa-miR-4760-5p	HITS-CLIP	27418678
MIRT739499	hsa-miR-4760-5p	HITS-CLIP	27418678
MIRT642058	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT642057	hsa-miR-3682-3p	HITS-CLIP	23824327
MIRT642054	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT642055	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT642059	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT642057	hsa-miR-3682-3p	HITS-CLIP	23824327
MIRT642056	hsa-miR-4284	HITS-CLIP	23824327
MIRT642054	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT642055	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT642059	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT642058	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT642057	hsa-miR-3682-3p	HITS-CLIP	23824327
MIRT642056	hsa-miR-4284	HITS-CLIP	23824327
MIRT642054	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT642055	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT1081832	hsa-miR-4659a-3p	CLIP-seq
MIRT1081833	hsa-miR-4659b-3p	CLIP-seq
MIRT1081834	hsa-miR-1184	CLIP-seq
MIRT1081835	hsa-miR-1205	CLIP-seq
MIRT1081836	hsa-miR-3130-3p	CLIP-seq
MIRT1081837	hsa-miR-3158-5p	CLIP-seq
MIRT1081838	hsa-miR-4768-5p	CLIP-seq
MIRT1081839	hsa-miR-4793-3p	CLIP-seq
MIRT2020297	hsa-miR-132	CLIP-seq
MIRT2020298	hsa-miR-212	CLIP-seq
MIRT2020299	hsa-miR-4328	CLIP-seq
MIRT2020300	hsa-miR-452	CLIP-seq
MIRT2020301	hsa-miR-4676-3p	CLIP-seq
MIRT2442288	hsa-miR-331-5p	CLIP-seq
MIRT2442289	hsa-miR-3647-3p	CLIP-seq
MIRT2442290	hsa-miR-4282	CLIP-seq
MIRT2442291	hsa-miR-513a-3p	CLIP-seq
MIRT2555416	hsa-miR-1224-3p	CLIP-seq
MIRT2555417	hsa-miR-1260	CLIP-seq
MIRT2555418	hsa-miR-1260b	CLIP-seq
MIRT2555419	hsa-miR-1263	CLIP-seq
MIRT2555420	hsa-miR-1273e	CLIP-seq
MIRT2555421	hsa-miR-1280	CLIP-seq
MIRT2555422	hsa-miR-1285	CLIP-seq
MIRT2020297	hsa-miR-132	CLIP-seq
MIRT2555423	hsa-miR-1324	CLIP-seq
MIRT2020298	hsa-miR-212	CLIP-seq
MIRT2555424	hsa-miR-224	CLIP-seq
MIRT2555425	hsa-miR-2909	CLIP-seq
MIRT2555426	hsa-miR-3125	CLIP-seq
MIRT2555427	hsa-miR-3126-3p	CLIP-seq
MIRT2555428	hsa-miR-3128	CLIP-seq
MIRT1081836	hsa-miR-3130-3p	CLIP-seq
MIRT2555429	hsa-miR-3153	CLIP-seq
MIRT2555430	hsa-miR-3162-5p	CLIP-seq
MIRT2555431	hsa-miR-3183	CLIP-seq
MIRT2555432	hsa-miR-3184	CLIP-seq
MIRT2555433	hsa-miR-3187-5p	CLIP-seq
MIRT2555434	hsa-miR-320e	CLIP-seq
MIRT2442288	hsa-miR-331-5p	CLIP-seq
MIRT2555435	hsa-miR-3613-3p	CLIP-seq
MIRT2442289	hsa-miR-3647-3p	CLIP-seq
MIRT2555436	hsa-miR-3655	CLIP-seq
MIRT2555437	hsa-miR-3671	CLIP-seq
MIRT2555438	hsa-miR-378g	CLIP-seq
MIRT2555439	hsa-miR-3910	CLIP-seq
MIRT2555440	hsa-miR-3916	CLIP-seq
MIRT2555441	hsa-miR-3942-3p	CLIP-seq
MIRT2555442	hsa-miR-410	CLIP-seq
MIRT2555443	hsa-miR-423-5p	CLIP-seq
MIRT2555444	hsa-miR-4252	CLIP-seq
MIRT2555445	hsa-miR-4257	CLIP-seq
MIRT2442290	hsa-miR-4282	CLIP-seq
MIRT2555446	hsa-miR-4311	CLIP-seq
MIRT2020299	hsa-miR-4328	CLIP-seq
MIRT2555447	hsa-miR-4436b-5p	CLIP-seq
MIRT2555448	hsa-miR-4470	CLIP-seq
MIRT2555449	hsa-miR-4486	CLIP-seq
MIRT2555450	hsa-miR-450b-5p	CLIP-seq
MIRT2555451	hsa-miR-4711-5p	CLIP-seq
MIRT2555452	hsa-miR-4715-3p	CLIP-seq
MIRT2555453	hsa-miR-4720-5p	CLIP-seq
MIRT2555454	hsa-miR-4723-3p	CLIP-seq
MIRT1081839	hsa-miR-4793-3p	CLIP-seq
MIRT2555455	hsa-miR-4799-3p	CLIP-seq
MIRT2555456	hsa-miR-485-3p	CLIP-seq
MIRT2555457	hsa-miR-499-3p	CLIP-seq
MIRT2555458	hsa-miR-499a-3p	CLIP-seq
MIRT2555459	hsa-miR-510	CLIP-seq
MIRT2555460	hsa-miR-512-5p	CLIP-seq
MIRT2442291	hsa-miR-513a-3p	CLIP-seq
MIRT2555461	hsa-miR-532-3p	CLIP-seq
MIRT2555462	hsa-miR-548a-5p	CLIP-seq
MIRT2555463	hsa-miR-548ab	CLIP-seq
MIRT2555464	hsa-miR-548ak	CLIP-seq
MIRT2555465	hsa-miR-548an	CLIP-seq
MIRT2555466	hsa-miR-548b-5p	CLIP-seq
MIRT2555467	hsa-miR-548c-5p	CLIP-seq
MIRT2555468	hsa-miR-548d-5p	CLIP-seq
MIRT2555469	hsa-miR-548h	CLIP-seq
MIRT2555470	hsa-miR-548i	CLIP-seq
MIRT2555471	hsa-miR-548j	CLIP-seq
MIRT2555472	hsa-miR-548n	CLIP-seq
MIRT2555473	hsa-miR-548w	CLIP-seq
MIRT2555474	hsa-miR-548y	CLIP-seq
MIRT2555475	hsa-miR-559	CLIP-seq
MIRT2555476	hsa-miR-570	CLIP-seq
MIRT2555477	hsa-miR-578	CLIP-seq
MIRT2555478	hsa-miR-612	CLIP-seq
MIRT2555479	hsa-miR-616	CLIP-seq
MIRT2555480	hsa-miR-622	CLIP-seq
MIRT2555416	hsa-miR-1224-3p	CLIP-seq
MIRT2555417	hsa-miR-1260	CLIP-seq
MIRT2555418	hsa-miR-1260b	CLIP-seq
MIRT2555420	hsa-miR-1273e	CLIP-seq
MIRT2555421	hsa-miR-1280	CLIP-seq
MIRT2555422	hsa-miR-1285	CLIP-seq
MIRT2020297	hsa-miR-132	CLIP-seq
MIRT2555423	hsa-miR-1324	CLIP-seq
MIRT2020298	hsa-miR-212	CLIP-seq
MIRT2555424	hsa-miR-224	CLIP-seq
MIRT2555426	hsa-miR-3125	CLIP-seq
MIRT2555427	hsa-miR-3126-3p	CLIP-seq
MIRT2555428	hsa-miR-3128	CLIP-seq
MIRT2555429	hsa-miR-3153	CLIP-seq
MIRT2555430	hsa-miR-3162-5p	CLIP-seq
MIRT2555431	hsa-miR-3183	CLIP-seq
MIRT2555433	hsa-miR-3187-5p	CLIP-seq
MIRT2442288	hsa-miR-331-5p	CLIP-seq
MIRT2555435	hsa-miR-3613-3p	CLIP-seq
MIRT2442289	hsa-miR-3647-3p	CLIP-seq
MIRT2555436	hsa-miR-3655	CLIP-seq
MIRT2555438	hsa-miR-378g	CLIP-seq
MIRT2555439	hsa-miR-3910	CLIP-seq
MIRT2555440	hsa-miR-3916	CLIP-seq
MIRT2555441	hsa-miR-3942-3p	CLIP-seq
MIRT2555442	hsa-miR-410	CLIP-seq
MIRT2555444	hsa-miR-4252	CLIP-seq
MIRT2442290	hsa-miR-4282	CLIP-seq
MIRT2555446	hsa-miR-4311	CLIP-seq
MIRT2555448	hsa-miR-4470	CLIP-seq
MIRT2555449	hsa-miR-4486	CLIP-seq
MIRT2555451	hsa-miR-4711-5p	CLIP-seq
MIRT2555452	hsa-miR-4715-3p	CLIP-seq
MIRT2555453	hsa-miR-4720-5p	CLIP-seq
MIRT2555454	hsa-miR-4723-3p	CLIP-seq
MIRT2555455	hsa-miR-4799-3p	CLIP-seq
MIRT2442291	hsa-miR-513a-3p	CLIP-seq
MIRT2683240	hsa-miR-520d-5p	CLIP-seq
MIRT2683241	hsa-miR-524-5p	CLIP-seq
MIRT2555461	hsa-miR-532-3p	CLIP-seq
MIRT2555462	hsa-miR-548a-5p	CLIP-seq
MIRT2555463	hsa-miR-548ab	CLIP-seq
MIRT2555464	hsa-miR-548ak	CLIP-seq
MIRT2555465	hsa-miR-548an	CLIP-seq
MIRT2555466	hsa-miR-548b-5p	CLIP-seq
MIRT2555467	hsa-miR-548c-5p	CLIP-seq
MIRT2555468	hsa-miR-548d-5p	CLIP-seq
MIRT2555469	hsa-miR-548h	CLIP-seq
MIRT2555470	hsa-miR-548i	CLIP-seq
MIRT2555471	hsa-miR-548j	CLIP-seq
MIRT2555472	hsa-miR-548n	CLIP-seq
MIRT2555473	hsa-miR-548w	CLIP-seq
MIRT2555474	hsa-miR-548y	CLIP-seq
MIRT2555475	hsa-miR-559	CLIP-seq
MIRT2555476	hsa-miR-570	CLIP-seq
MIRT2555477	hsa-miR-578	CLIP-seq
MIRT2555478	hsa-miR-612	CLIP-seq
MIRT2555479	hsa-miR-616	CLIP-seq
MIRT2555480	hsa-miR-622	CLIP-seq
MIRT2555432	hsa-miR-3184	CLIP-seq
MIRT2555443	hsa-miR-423-5p	CLIP-seq

Show/Hide all (76)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003231	Process	Cardiac ventricle development	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005267	Function	Potassium channel activity	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007613	Process	Memory	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009986	Component	Cell surface	IEA
GO:0014047	Process	Glutamate secretion	IEA
GO:0014047	Process	Glutamate secretion	ISS
GO:0015271	Function	Outward rectifier potassium channel activity	IBA
GO:0015271	Function	Outward rectifier potassium channel activity	IEA
GO:0015271	Function	Outward rectifier potassium channel activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019228	Process	Neuronal action potential	IEA
GO:0019228	Process	Neuronal action potential	ISS
GO:0019870	Function	Potassium channel inhibitor activity	ISS
GO:0022834	Function	Ligand-gated channel activity	IEA
GO:0022834	Function	Ligand-gated channel activity	ISS
GO:0022841	Function	Potassium ion leak channel activity	IBA
GO:0022841	Function	Potassium ion leak channel activity	IEA
GO:0022841	Function	Potassium ion leak channel activity	ISS
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	IEA
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	ISS
GO:0033268	Component	Node of Ranvier	IEA
GO:0033268	Component	Node of Ranvier	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0044305	Component	Calyx of Held	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0048678	Process	Response to axon injury	IEA
GO:0050976	Process	Detection of mechanical stimulus involved in sensory perception of touch	IEA
GO:0050976	Process	Detection of mechanical stimulus involved in sensory perception of touch	ISS
GO:0060044	Process	Negative regulation of cardiac muscle cell proliferation	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:0090102	Process	Cochlea development	IEA
GO:0097449	Component	Astrocyte projection	IEA
GO:0097449	Component	Astrocyte projection	ISS
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098782	Function	Mechanosensitive potassium channel activity	IDA	38605031
GO:0098782	Function	Mechanosensitive potassium channel activity	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0099565	Process	Chemical synaptic transmission, postsynaptic	IEA
GO:1900039	Process	Positive regulation of cellular response to hypoxia	IEA
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	ISS
GO:1904551	Process	Cellular response to arachidonate	IEA
GO:1904551	Process	Cellular response to arachidonate	ISS
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IEA

MIM	HGNC	e!Ensembl
603219	6277	ENSG00000082482

O95069

Protein name

Potassium channel subfamily K member 2 (Outward rectifying potassium channel protein TREK-1) (TREK-1 K(+) channel subunit) (Two pore domain potassium channel TREK1) (Two pore potassium channel TPKC1) (K2P2.1)

Protein function

K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate.

PDB

4TWK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07885	Ion_trans_2	117 → 197	Ion channel	Family
PF07885	Ion_trans_2	233 → 313	Ion channel	Family

Tissue specificity

TISSUE SPECIFICITY: [Isoform 3]: Detected in kidney, adrenal gland and brain where it is preferentially expressed in the amygdala but not found in thalamus, hypothalamus, hippocampus or substantia nigra. {ECO:0000269|PubMed:24196565}.

Sequence

MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK

Sequence length

426

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
EBV-positive nodal T- and NK-cell lymphoma	Uncertain significance	rs368923002	RCV004557749

Show/Hide Text Mining Associations (22)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Alzheimer Disease	Associate	30519892
Arrhythmias Cardiac	Associate	28242754
Atrophy	Associate	30519892
Bipolar Disorder	Associate	29156592
Brain Ischemia	Associate	14522822
Carcinoma Hepatocellular	Inhibit	31581133
Chemical and Drug Induced Liver Injury	Associate	35177207
Cognition Disorders	Associate	30519892
Dementia Vascular	Associate	39909351
Depressive Disorder	Associate	19621370, 29156592
Depressive Disorder Major	Associate	29156592
Diabetes Gestational	Stimulate	36909311
Endometrial Neoplasms	Associate	23305490
Inflammation	Associate	30519892, 33217242
Liver Cirrhosis	Associate	35177207
Migraine Disorders	Associate	30653930
Neoplasms	Associate	24116006
Pain	Associate	26914156
Signs and Symptoms	Associate	19621370
Tachycardia Ventricular	Associate	28242754
Urinary Bladder Overactive	Associate	28539337
Ventricular Outflow Obstruction Right	Associate	28242754

KCNK2 (potassium two pore domain channel subfamily K member 2)