Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3776
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium two pore domain channel subfamily K member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNK2
Synonyms (NCBI Gene) Gene synonyms aliases
K2p2.1, TPKC1, TREK, TREK-1, TREK1, hTREK-1c, hTREK-1e
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q41
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes one of the members of the two-pore-domain background potassium channel protein family. This type of potassium channel is formed by two homodimers that create a channel that leaks potassium out of the cell to control resting membrane pote
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022916 hsa-miR-124-3p Microarray 18668037
MIRT642058 hsa-miR-5571-5p HITS-CLIP 23824327
MIRT642057 hsa-miR-3682-3p HITS-CLIP 23824327
MIRT642054 hsa-miR-4753-3p HITS-CLIP 23824327
MIRT642055 hsa-miR-6809-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003231 Process Cardiac ventricle development IEA
GO:0005634 Component Nucleus IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603219 6277 ENSG00000082482
Protein
UniProt ID O95069
Protein name Potassium channel subfamily K member 2 (Outward rectifying potassium channel protein TREK-1) (TREK-1 K(+) channel subunit) (Two pore domain potassium channel TREK1) (Two pore potassium channel TPKC1) (K2P2.1)
Protein function K(+) channel that conducts voltage-dependent outward rectifying currents upon membrane depolarization. Voltage sensing is coupled to K(+) electrochemical gradient in an 'ion flux gating' mode where outward but not inward ion flow opens the gate.
PDB 4TWK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07885 Ion_trans_2 117 197 Ion channel Family
PF07885 Ion_trans_2 233 313 Ion channel Family
Tissue specificity TISSUE SPECIFICITY: [Isoform 3]: Detected in kidney, adrenal gland and brain where it is preferentially expressed in the amygdala but not found in thalamus, hypothalamus, hippocampus or substantia nigra. {ECO:0000269|PubMed:24196565}.
Sequence
MLPSASRERPGYRAGVAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQ
IVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLG
TIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAIIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRV
ISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
IKRKLSAELAGNHNQELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIA
VIENIK
Sequence length 426
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Breast cancer Breast cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 30519892
Arrhythmias Cardiac Associate 28242754
Atrophy Associate 30519892
Bipolar Disorder Associate 29156592
Brain Ischemia Associate 14522822
Carcinoma Hepatocellular Inhibit 31581133
Chemical and Drug Induced Liver Injury Associate 35177207
Cognition Disorders Associate 30519892
Dementia Vascular Associate 39909351
Depressive Disorder Associate 19621370, 29156592